EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL32_ORYSJ (Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.721e-34
Identity = 80/191 (41.88%), Postives = 114/191 (59.69%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPA---GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALF--ANNLSSQLVEQTTFLDDATVKRLKA 639
            M+ D CVAD K    P    G PC     VTA+DF F GL  AGNTT+ + + VT A V + P +N +G+S+AR+D A  G+ P HTHP A+EI+ V  G +  GF+ ++AN ++ +T+ KG++ +FP+GL+HFQ NSG   AL   +FNS  PG Q     LF  A  L S  + +   +D   V+ +K+
Sbjct:   27 MLQDVCVADYKSLRGPLRLNGIPCKRLENVTANDFFFDGLTNAGNTTNAVGSLVTAASVERLPGLNTMGVSMARIDYAPWGLSPPHTHPRATEIMFVAEGTLDVGFV-TTANKLFTRTVSKGEVFVFPRGLVHFQRNSGNTSALAIAAFNSQLPGTQSIADTLFGAAPPLPSDTLARAFQVDGGMVESIKS 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL22_ORYSJ (Putative germin-like protein 2-2 OS=Oryza sativa subsp. japonica GN=Os02g0491700 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 6.166e-34
Identity = 76/189 (40.21%), Postives = 113/189 (59.79%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGF-ISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFAN--NLSSQLVEQTTFLDDATVKRLKA 639
            ++ DFCV D        G+PC     V A DF FSGL +AGNTT+   + VT   VAQ P +N +G+SL R+D A  G+ P HTHP A+EI  V+ G +  GF IS+  N ++ K L KGD+ +FPQGL+HFQ N+G + A+   + +S NPG+     A+F +  ++S  ++ +   +D   + R++A
Sbjct:   33 LLQDFCVVDKMSQVRVNGFPCKDAKDVVAGDFFFSGLHMAGNTTNKQGSNVTTVNVAQIPGLNTMGVSLVRIDYAPNGLNPPHTHPRATEIPTVLEGSLYVGFVISNPENKLFTKVLNKGDVFVFPQGLVHFQFNNGTNNAVALAALSSQNPGVITVGNAVFGSKPSISDDILAKAFQVDKNIIDRIQA 221          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL21_ORYSJ (Putative germin-like protein 2-1 OS=Oryza sativa subsp. japonica GN=Os02g0491600 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.794e-33
Identity = 75/190 (39.47%), Postives = 114/190 (60.00%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS-ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + + DFCVAD        G+ C  PA +T +DF FSGL +AGNT++   +AVT   VAQ   +N LG+SLAR+D A  G+ P H HP A+EIL ++ G +  GF++S+  N ++ K L KGD+ +FPQGL+HFQ N G    +   + +S NPG+     A+F +   +S  ++ +   ++   V R++A
Sbjct:   25 SQLQDFCVADKMSQVLVNGFACKDPAAITVEDFFFSGLHMAGNTSNRQGSAVTGVNVAQISGLNTLGISLARVDYAPYGLNPPHIHPRATEILTILEGSLYVGFVTSNPENKLFTKVLNKGDVFVFPQGLIHFQFNYGTKDVIALAALSSQNPGVITIANAVFGSKPFISDDILAKAFQVEKKIVDRIQA 214          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL52_ORYSJ (Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.060e-33
Identity = 74/162 (45.68%), Postives = 101/162 (62.35%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFA 567
            ++ D CVADL  +    G+ C   A VT DDF F GL  AGNT +   + VT A V + P +N LG+S++R+D A GG+ P HTHP A+E++ V+ G +  GFI ++AN +Y KT+  GD+ +FP+GLLHFQ N+G   A    +FNS  PG Q     LFA
Sbjct:   30 LLQDICVADLTSAVKVNGFAC--KAAVTEDDFYFKGLAAAGNTNNTYGSVVTGANVEKLPGLNTLGVSMSRIDYAPGGLNPPHTHPRATEMVFVLQGTLDVGFI-TTANKLYTKTISAGDVFVFPRGLLHFQKNNGDTPAAVISAFNSQLPGTQSLAMTLFA 188          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLT2_ARATH (Germin-like protein subfamily T member 2 OS=Arabidopsis thaliana GN=At1g18980 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 5.220e-33
Identity = 79/187 (42.25%), Postives = 115/187 (61.50%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCV DLK S S  G+PC   + V+A DF FSGLG   NT++    AV+PA V  FP +N LGLS+  ++ A GGV P H+HP A+E  +V+ G +  GF++++ NT++ K L  G++ + P+GL+HFQ N G   A    SFNS  PG  +    LF +N  + + ++ +T   DD TV +LK+
Sbjct:   33 LQDFCVGDLKASPSINGFPC--KSSVSASDFFFSGLGGPLNTSTPNGVAVSPANVLTFPGLNTLGLSMNNVEFAPGGVNPPHSHPRATEAGVVIEGSVFVGFLTTN-NTLFSKVLNAGEMFVVPRGLVHFQWNVGKVKARLITSFNSQLPGSAVLPSTLFGSNPTIPNAVLTKTFRTDDVTVNKLKS 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL23_ORYSJ (Putative germin-like protein 2-3 OS=Oryza sativa subsp. japonica GN=Os02g0491800 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.519e-32
Identity = 75/188 (39.89%), Postives = 115/188 (61.17%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS-ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFAN--NLSSQLVEQTTFLDDATVKRLKA 639
            + D CVAD   +    G  C     V A+DF FSGL +AGNTT+   +AVT   VAQ P +N LG+SLAR+D A  G+ P HTHP A+EIL V+ G +  GF++S+  N ++ K + KGD+ +FP+GL+HFQ N G   A+  V+ +S NPG+     A+F +  +++  ++ +   ++   V +++A
Sbjct:   34 LQDLCVADKASTVRVNGVACKDGEDVAAEDFFFSGLHMAGNTTNKQGSAVTAVNVAQVPGLNTLGISLARIDYALHGLNPPHTHPRATEILTVLEGSLYVGFVTSNPENKLFTKVINKGDVFVFPKGLVHFQFNYGTTDAVAIVALSSQNPGVITVANAVFGSKPSITDDILAKAFQVEKTVVDQIQA 221          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL13_ORYSJ (Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.519e-32
Identity = 78/191 (40.84%), Postives = 113/191 (59.16%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPA---GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALF--ANNLSSQLVEQTTFLDDATVKRLKA 639
            M+ D CVAD K    P    G+PC     VTA+DF F GL  AGNT + + + VT A V   P +N +G+S+AR+D A  G+ P HTHP A+EI+ VV G +  GF+ ++AN ++ +T+ KG++ +FP+GL+HFQ N+G   A    + NS  PG Q    ALF  A  L S  + +   +D   V+ +K+
Sbjct:   27 MLQDVCVADYKSLKGPLRLNGFPCKRIENVTANDFFFDGLMKAGNTGNAVGSVVTAASVESLPGLNTMGVSMARIDYAPWGLNPPHTHPRATEIIFVVEGSLDVGFV-TTANKLFTRTVCKGEVFVFPRGLVHFQKNNGNTPAFAIAALNSQLPGTQSIAAALFGAAPPLPSDTLARAFQVDGGMVEFIKS 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL16_ARATH (Germin-like protein subfamily 1 member 6 OS=Arabidopsis thaliana GN=At3g04200 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.771e-32
Identity = 81/194 (41.75%), Postives = 118/194 (60.82%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPA-GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPG-LQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILG 648
            + DFCVA  + +     G  C  P  VTA+DF +SGL +A NTT+ + + VT   V + P +N LG+SLARLD A+GG  P H HP A+EIL+V  G +  GF+SS+   N ++ K LK+GD+ +FP GL+HFQ+N     A+ F  F S NPG ++I D A+F +N  +  +++ +   LD   V+ L  + G
Sbjct:   31 LQDFCVAASETNRVFVNGKFCKDPKSVTANDFSYSGLNIARNTTNFLGSNVTTVDVNKIPGLNTLGVSLARLDFAQGGQNPPHIHPRATEILVVTKGKLLVGFVSSNQDNNRLFYKVLKRGDVFVFPIGLIHFQMNVRRTRAVAFAGFGSQNPGTIRIAD-AVFGSNPSIPQEVLAKAFQLDVKLVRFLHIVFG 223          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL11_ORYSJ (Germin-like protein 1-1 OS=Oryza sativa subsp. japonica GN=GER4 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.771e-32
Identity = 76/162 (46.91%), Postives = 99/162 (61.11%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFA 567
            M+ D CVADL       G+PC   A VTADDF F+GL   GNT +   + VT A V  FP VN LG+S+AR+D A GG  P HTHP A+EI+ V+ G +  GFI ++AN ++ KT+  G++ +FP+GL+HFQ N G   A    +FNS   G Q     LFA
Sbjct:   29 MLQDVCVADLASPVKLNGFPC--KANVTADDFFFAGLKNPGNTNNPAGSNVTAANVQSFPGVNTLGVSMARIDYAPGGQNPPHTHPRATEIIFVLEGVLEVGFI-TTANKLFTKTVTAGEVFVFPRGLVHFQQNRGHGPAAVIAAFNSQLQGTQAIAATLFA 187          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL51_ORYSJ (Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0197200 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.679e-31
Identity = 82/191 (42.93%), Postives = 111/191 (58.12%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLG--VAGNTTSIINAAVTPAFVAQ---FPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANT-VYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD        G PC  PA VTADDF FSG+G   AG       A+    F A+    P +N LG S AR+D+A GGV P H HP ASE  +V+ G +  GF++S  ++ V  K L++GD+   PQGL+HF  N+G++ A  + S +S NPGL +   AL A  L   LV +T   D+ATV +++A
Sbjct:   34 LQDFCVADPTSKVRVNGLPCKDPAAVTADDFFFSGVGEPAAGGGRGA-TASRRYGFTARSVDIPGLNTLGASAARVDVAPGGVFPPHYHPRASETAVVLAGAVYFGFVTSYPDSRVVAKVLRRGDVFAVPQGLVHFLHNNGSEPAALYASLSSQNPGLVLVADALLAAPLPVDLVAKTLLTDEATVDKIRA 223          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
GL32_ORYSJ4.721e-3441.88Putative germin-like protein 3-2 OS=Oryza sativa s... [more]
GL22_ORYSJ6.166e-3440.21Putative germin-like protein 2-2 OS=Oryza sativa s... [more]
GL21_ORYSJ1.794e-3339.47Putative germin-like protein 2-1 OS=Oryza sativa s... [more]
GL52_ORYSJ3.060e-3345.68Germin-like protein 5-1 OS=Oryza sativa subsp. jap... [more]
GLT2_ARATH5.220e-3342.25Germin-like protein subfamily T member 2 OS=Arabid... [more]
GL23_ORYSJ1.519e-3239.89Putative germin-like protein 2-3 OS=Oryza sativa s... [more]
GL13_ORYSJ1.519e-3240.84Germin-like protein 1-3 OS=Oryza sativa subsp. jap... [more]
GL16_ARATH5.771e-3241.75Germin-like protein subfamily 1 member 6 OS=Arabid... [more]
GL11_ORYSJ5.771e-3246.91Germin-like protein 1-1 OS=Oryza sativa subsp. jap... [more]
GL51_ORYSJ1.679e-3142.93Germin-like protein 5-1 OS=Oryza sativa subsp. jap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top