EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL41_ORYSJ (Germin-like protein 4-1 OS=Oryza sativa subsp. japonica GN=Os04g0617900 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 2.864e-31
Identity = 72/169 (42.60%), Postives = 101/169 (59.76%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVF-SGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS----ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFAN 570
            + + DFCVAD   +    G+ C  P  VTA+DF     LGV GNT +   +AVTP  V + P +N LG+S AR+D A  G  P HTHP A+EIL V+ G +  GF++S+     N  + K L  GD+ +FPQGL+HFQ+N+GA  A+   + +S NPG+     A+F +
Sbjct:   31 SQLQDFCVADKLSAVFVNGFVCKNPKQVTANDFFLPKALGVPGNTVNAQGSAVTPVTVNELPGLNTLGISFARIDFAPNGQNPPHTHPRATEILTVLQGTLLVGFVTSNQPGGGNLQFTKLLGPGDVFVFPQGLIHFQLNNGAVPAVAIAALSSQNPGVITIANAVFGS 199          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL24_ORYSJ (Germin-like protein 2-4 OS=Oryza sativa subsp. japonica GN=Os02g0532500 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.886e-31
Identity = 81/198 (40.91%), Postives = 117/198 (59.09%), Query Frame = 1
Query:   85 VNDFCVAD------LKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGN---TTSIINAAVTPAFVAQFPAVNGLGLSLARLDL-AKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLKAILG 648
            V DFCV D      ++L+  PA YPC  PA +TA DF FSG+  AGN    T     +VTPA   QFP ++ LG+S AR DL A GGV P H HP A+E  LV+ G + AGF+ S    ++ K L++G++M+FP+ ++HFQ+N G   A  + +FNS NPG+      +F + +   ++E+   L  A ++RL+   G
Sbjct:   28 VQDFCVPDAGRGRPVELAMLPA-YPCRSPANLTAGDFAFSGVRAAGNFSPETGFAGVSVTPA---QFPGLHTLGMSFARADLSAAGGVNPPHYHPRATETALVLAGRVYAGFVDSGGR-LFAKVLEQGEVMVFPRAMVHFQLNVGDTPATVYGAFNSENPGIVRIPATVFGSGIREAVLERAFGLTPAELRRLEKRFG 220          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL12_ORYSJ (Germin-like protein 1-2 OS=Oryza sativa subsp. japonica GN=Os01g0705100 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.886e-31
Identity = 72/191 (37.70%), Postives = 115/191 (60.21%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILGG 651
            + D CVADL+ + +  G+PC P A V +DDF    +  A +T++      T A V+ FP +N LGLS+ R DLA GG+ P H+HP ASE++LV+ G +  GF +++AN ++ K +++ ++ + P+GL HFQ+N GA  A     F+S +PGL    FALFA    +  +++ +T  + +  V  +K+   G
Sbjct:   34 LQDICVADLRAATAVDGFPCKPTASVVSDDFFCDAIVQAPSTSNPFGVNSTRATVSAFPGLNTLGLSITRTDLAPGGLNPPHSHPRASELVLVLSGEVMVGF-TTAANRLFSKVVREKELFVVPRGLQHFQLNVGAGNASFVAMFDSQSPGLVTPTFALFATQPAMPMEVLAKTFLMGEDEVGAIKSKFAG 223          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL38_ORYSJ (Germin-like protein 3-8 OS=Oryza sativa subsp. japonica GN=Os03g0804700 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.856e-30
Identity = 76/195 (38.97%), Postives = 113/195 (57.95%), Query Frame = 1
Query:   85 VNDFCVA------DLKLSDSPA--GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            V DFCVA      D   +  PA  G+PC P + V +DDF F+GL VA +T +     VT A    FP +N LG+S+ R+DLA GGV P+H+HP A+E++ VV G + AGF+ S+A   Y K L +G+  + P+G++HFQ N G   A    +FNS  PG+      LF ++  +   ++ ++  +D   +K LK+
Sbjct:   30 VQDFCVAVVPRAGDAAAAACPAYPGFPCKPASTVVSDDFFFAGLAVASDTDNRFGFNVTAANAETFPGLNTLGVSIGRVDLAPGGVNPLHSHPRATELIHVVAGRVLAGFV-STAGEFYSKVLGEGETFVVPRGMIHFQYNVGGVAAQVITAFNSQMPGVVAAGSTLFGSDPEIPDAVLAKSFQVDAKIIKLLKS 223          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL120_ARATH (Germin-like protein subfamily 1 member 20 OS=Arabidopsis thaliana GN=GLP5A PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.856e-30
Identity = 80/194 (41.24%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILG 648
            + DFCVA  DLK      G  C  P  V A DF FSGL V GNT + + + VT   V Q P +N +G+SL R+D A  G  P HTHP  SEIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +N  +  +L+ +   LD + VK L+A  G
Sbjct:   28 LQDFCVAIDDLK-GVFVNGRFCKDPKRVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKFG 220          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLT1_ARATH (Germin-like protein subfamily T member 1 OS=Arabidopsis thaliana GN=GLP1 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 3.167e-30
Identity = 74/187 (39.57%), Postives = 110/187 (58.82%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFAN--NLSSQLVEQTTFLDDATVKRLKA 639
            + DFCV DLK S S  G+PC   + V+A DF +SGLG   +T++     V PA V  FP +N LG+S+  ++LA GGV P H HP A+E+  V+ G +  GF+S++ NT++ K L  G+  + P+GL+HFQ N G   A    +FNS  PG  +    LF +   + + ++ +    DD TV+ LK+
Sbjct:   33 LQDFCVGDLKASASINGFPC--KSAVSASDFFYSGLGGPLDTSNPNGVTVAPANVLTFPGLNTLGISMNNVELAPGGVNPPHLHPRATEVGTVIEGSVFVGFLSTN-NTLFSKVLNAGEAFVIPRGLVHFQWNVGQVKARMITAFNSQLPGAVVLPSTLFGSKPEIPNAVLTRAFRTDDTTVQNLKS 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL23_ARATH (Germin-like protein subfamily 2 member 3 OS=Arabidopsis thaliana GN=GLP8 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.167e-30
Identity = 71/165 (43.03%), Postives = 99/165 (60.00%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTT-SIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN 573
            M+ DFCVADL       GYPC  PA VT +DF F GL  A  T  S + +AVT A V + P +N LG+S++R+D A GG+ P H HP ASE + V+ G +  GF++++   +  K + KGD+ +FP+ LLHFQ N     A    +F+S  PG Q+   +LF +N
Sbjct:   26 MLQDFCVADLSNGLKVNGYPCKDPAKVTPEDFYFIGLATAAATANSSMGSAVTGANVEKVPGLNTLGVSISRIDYAPGGLNPPHLHPRASEAIFVLEGRLFVGFLTTTGKLI-SKHVNKGDVFVFPKALLHFQQNPNKAPASVLAAFDSQLPGTQVVGPSLFGSN 189          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL21_ARATH (Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana GN=GLP4 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.167e-30
Identity = 71/161 (44.10%), Postives = 96/161 (59.63%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALF 564
            M+ D CVADL       G+PC   A VT+ DF   GL   G T +   A VT A V   P +N LG+SL+R+D A GG+ P HTHP A+E++ V+ G +  GF+ ++AN +  ++LKKGD+  FP+GL+HFQ N+G   A    +FNS  PG Q     LF
Sbjct:   27 MLQDLCVADLPSGIKINGFPCKDAATVTSADFFSQGLAKPGLTNNTFGALVTGANVMTIPGLNTLGVSLSRIDYAPGGLNPPHTHPRATEVVFVLEGTLDVGFL-TTANKLISQSLKKGDVFAFPKGLVHFQKNNGDVPASVIAAFNSQLPGTQSLGATLF 186          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL17_ARATH (Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.136e-30
Identity = 77/193 (39.90%), Postives = 111/193 (57.51%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPA----GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFAN--NLSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA   + D+      G  C  P  V A+DF  SGL +AGNT + + + VT   V + P +N LG+SL R+D A GG  P HTHP A+EIL+VV G +  GF++S+   N ++ K L  GD+ +FP G++HFQVN G   A+ F    S NPG      A+F +  ++  +++ +   LD   VK L+A
Sbjct:   30 LQDFCVA---VDDASGVFVNGKFCKDPKYVKAEDFFTSGLNIAGNTINRVGSNVTNVNVDKIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVVVEGTLLVGFVTSNQDNNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNAVAFAGLGSQNPGTITIADAVFGSKPSIMPEILAKAFQLDVNVVKYLEA 219          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL118_ARATH (Germin-like protein subfamily 1 member 18 OS=Arabidopsis thaliana GN=GLP2A PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 4.136e-30
Identity = 79/194 (40.72%), Postives = 110/194 (56.70%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILG 648
            + DFCVA  DLK      G  C  P  V A DF FSGL + GNT + + + VT   V Q P +N +G+SL R+D A  G  P HTHP  SEIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +N  +  +L+ +   LD + VK L+A  G
Sbjct:   28 LQDFCVAIDDLK-GVFVNGRFCKDPKRVDAKDFFFSGLNMPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKFG 220          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
GL41_ORYSJ2.864e-3142.60Germin-like protein 4-1 OS=Oryza sativa subsp. jap... [more]
GL24_ORYSJ4.886e-3140.91Germin-like protein 2-4 OS=Oryza sativa subsp. jap... [more]
GL12_ORYSJ4.886e-3137.70Germin-like protein 1-2 OS=Oryza sativa subsp. jap... [more]
GL38_ORYSJ1.856e-3038.97Germin-like protein 3-8 OS=Oryza sativa subsp. jap... [more]
GL120_ARATH1.856e-3041.24Germin-like protein subfamily 1 member 20 OS=Arabi... [more]
GLT1_ARATH3.167e-3039.57Germin-like protein subfamily T member 1 OS=Arabid... [more]
GL23_ARATH3.167e-3043.03Germin-like protein subfamily 2 member 3 OS=Arabid... [more]
GL21_ARATH3.167e-3044.10Germin-like protein subfamily 2 member 1 OS=Arabid... [more]
GL17_ARATH4.136e-3039.90Germin-like protein subfamily 1 member 7 OS=Arabid... [more]
GL118_ARATH4.136e-3040.72Germin-like protein subfamily 1 member 18 OS=Arabi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top