EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL112_ARATH (Putative germin-like protein subfamily 1 member 12 OS=Arabidopsis thaliana GN=At5g38960 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.136e-30
Identity = 81/198 (40.91%), Postives = 111/198 (56.06%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPA------GYPCVPPAMVTADDFVFSGLGVAGNT-TSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISS-SANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILG 648
            + DFC+      ++PA      G  C  P +VTADDF FSGL  A  T +S + + VT   V Q P +N LG+SL R+D    G  P HTHP A+EILLV  G +  GF SS   N ++ KTL KGD+ +FP+GL+HFQVN G   A+ F S +S NPG+ I    LF +   +   ++ +   LD   + +L+   G
Sbjct:   30 LQDFCIG----VNTPANALFVNGKFCKDPKLVTADDFYFSGLDKARTTESSPVGSNVTTVNVNQIPGLNTLGISLVRIDYGINGQNPPHTHPRATEILLVQEGTLFVGFFSSFPENRLFNKTLNKGDVFVFPEGLIHFQVNIGKQPAVAFASLSSQNPGVIIIGNTLFGSKPPIDPNVLAKAFQLDPKVIIQLQKKFG 223          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL116_ARATH (Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.055e-30
Identity = 79/194 (40.72%), Postives = 109/194 (56.19%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILG 648
            + DFCVA  DLK      G  C  P  V A DF FSGL V GNT + + + VT   V Q P +N +G+SL R+D A  G  P HTHP  SEIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQ+N G   A+ F   +S N G+      +F +N  +  +L+ +   LD   VK L+A  G
Sbjct:   28 LQDFCVAIDDLK-GVFVNGRFCKDPERVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQLNIGKIPAIAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDANVVKELQAKFG 220          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL37_ORYSJ (Germin-like protein 3-7 OS=Oryza sativa subsp. japonica GN=GER7 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 9.214e-30
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 1
Query:   85 VNDFCVADLKLSD--SPA--GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  +     SPA  G+PC P + V +DDF F+GL  AG+T +   A++ P  V  FPA+N LG+++ R+DLA GGV P+H+HP A+E++ V+ G +  GF+ S+A   Y K + +G+    P+GL+HFQ N G   A     FNS  PG+     ALF  +  +   ++ ++  +D   +K LK+
Sbjct:   40 IQDFCVAVPRAGGEASPAYPGFPCKPASAVVSDDFFFAGLAAAGSTDNPFGASLKPGNVEAFPALNTLGVAINRVDLAPGGVNPLHSHPRAAELVHVITGRMLVGFV-STAGKYYSKVVGEGETFAIPRGLMHFQYNPGNASARAMTVFNSQLPGVVPAATALFGADPEIPDAVLAKSFQVDAEIIKLLKS 229          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL114_ARATH (Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.572e-29
Identity = 76/191 (39.79%), Postives = 107/191 (56.02%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  DLK      G  C  P    A+DF +SGL  AG T + + + VT   V Q P +N LG+SL R+D A  G  P HTHP A+EIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +   ++  ++ Q   LD   VK L+A
Sbjct:   28 LQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFYSGLNQAGTTNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEA 218          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL113_ARATH (Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.681e-29
Identity = 75/191 (39.27%), Postives = 108/191 (56.54%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  DLK      G  C  P    A+DF FSGL  AG+T + + + VT   V Q P +N +G+SL R+D A  G  P HTHP A+EIL+++ G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +   ++  ++ Q   LD   VK L+A
Sbjct:   28 LQDFCVAIDDLKNGVFVNGKFCKDPKQAKAEDFFFSGLNQAGSTNNKVRSNVTTVNVDQIPGLNTMGISLVRIDYAPYGQNPPHTHPRATEILVLIEGTLYVGFVSSNQDNNRLFAKVLYPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNIVKDLEA 218          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GLP1_MESCR (Germin-like protein OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 5.972e-29
Identity = 70/175 (40.00%), Postives = 98/175 (56.00%), Query Frame = 1
Query:   85 VNDFCVADLKLSDS--PAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS----ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLV 591
            + DFCV   K +D     G  C  P  V  DDF+F GL +  NT + +  A T    A  P +N LG+S+ARLD A  G+ P HTHP A+E+ +V+ G    GF++S+     N ++ K L KGD+ +FPQGL+HFQ+N G    +G    +S NPG+     A+F     SQL+
Sbjct:   28 LQDFCVGVNKPNDGLFVNGLFCKDPMEVNPDDFLFRGLNMPANTDNALGFAATLVTAANLPGLNTLGISVARLDFAPHGLNPPHTHPRATEVFVVLEGTFYVGFVTSNLADGGNKLFAKVLNKGDVFVFPQGLIHFQLNIGNYPGVGISGLSSQNPGVITIANAVFGPEHLSQLM 202          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL24_ARATH (Germin-like protein subfamily 2 member 4 OS=Arabidopsis thaliana GN=GLP10 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 5.972e-29
Identity = 67/161 (41.61%), Postives = 99/161 (61.49%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSG-ADGALGFVSFNSPNPGLQITDFALF 564
            + D CVAD        G+ C P + +TA DF F+G+G      + + +AVT A V +   +N LG+SLAR+D A GG+ P HTHP A+E++ V+ G +  GFI ++AN ++ KT+KKG++ +FP+GL+H+Q N+  A  A    +FNS  PG Q     LF
Sbjct:   27 LQDLCVADRTSGIKVNGFTCKPESNITASDFFFAGIGKPAVVNNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGFI-TTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVISAFNSQLPGTQSIAATLF 186          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL22_ARATH (Germin-like protein subfamily 2 member 2 OS=Arabidopsis thaliana GN=At1g02335 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.330e-28
Identity = 66/161 (40.99%), Postives = 95/161 (59.01%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFA 567
            + D CVAD        G+PC     +T  DF F+G+       S + +AVT A V + P +N L +SLAR+D A GG+ P HTHP A+E++ V+ G +  GFI ++AN ++ KT+K G++ +FP+GL+HFQ N+G   A    +FNS  PG       LFA
Sbjct:   28 LQDLCVADKSHGTKLNGFPCKETLNITESDFFFAGISKPAVINSTMGSAVTGANVEKIPGLNTLSVSLARIDYAPGGLNPPHTHPRATEVVYVLEGELEVGFI-TTANKLFTKTIKIGEVFVFPRGLVHFQKNNGKSPASVLSAFNSQLPGTASVAATLFA 187          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: OXO2_HORVU (Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.964e-28
Identity = 72/167 (43.11%), Postives = 100/167 (59.88%), Query Frame = 1
Query:   85 VNDFCVADLK-LSDSPAGYPCVPPAMVTADDFVFSG-LGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISS--SANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN 573
            + DFCVADL   + S  G+PC P +    DDF+FS  L  AGNT++   +AVT   VA++P  N LG+S+ R+D A GG  P H HP A+EI +V+ G +  G + S  S N +Y + ++ G+  + P+GL+HFQ N G   A   VSFNS NPG+      LF +N
Sbjct:   29 LQDFCVADLDGKAVSVNGHPCKPMSEA-GDDFLFSSKLAKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHVHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGETFLIPRGLMHFQFNVGKTEASMVVSFNSQNPGIVFVPLTLFGSN 194          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL34_ARATH (Germin-like protein subfamily 3 member 4 OS=Arabidopsis thaliana GN=At5g61750 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.871e-28
Identity = 59/136 (43.38%), Postives = 89/136 (65.44%), Query Frame = 1
Query:  133 GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGL 540
            GYPC  P  +TA DF  + L  AG+T + + + VT     +FP +N LGLS++R DL + G +P H+HP +SE+L VV G + AGF+ ++ N ++   L+KGD+ +FP+GLLHF ++ G + A  F  +NS NPG+
Sbjct:   41 GYPCKNPTKITAQDFKSTKLTEAGDTDNYLQSNVTLLTALEFPGLNTLGLSVSRTDLERDGSVPFHSHPRSSEMLFVVKGVVFAGFVDTN-NKIFQTVLQKGDVFVFPKGLLHFCLSGGFEPATAFSFYNSQNPGV 175          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
GL112_ARATH4.136e-3040.91Putative germin-like protein subfamily 1 member 12... [more]
GL116_ARATH7.055e-3040.72Germin-like protein subfamily 1 member 16 OS=Arabi... [more]
GL37_ORYSJ9.214e-3038.74Germin-like protein 3-7 OS=Oryza sativa subsp. jap... [more]
GL114_ARATH1.572e-2939.79Germin-like protein subfamily 1 member 14 OS=Arabi... [more]
GL113_ARATH2.681e-2939.27Germin-like protein subfamily 1 member 13 OS=Arabi... [more]
GLP1_MESCR5.972e-2940.00Germin-like protein OS=Mesembryanthemum crystallin... [more]
GL24_ARATH5.972e-2941.61Germin-like protein subfamily 2 member 4 OS=Arabid... [more]
GL22_ARATH1.330e-2840.99Germin-like protein subfamily 2 member 2 OS=Arabid... [more]
OXO2_HORVU2.964e-2843.11Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1[more]
GL34_ARATH3.871e-2843.38Germin-like protein subfamily 3 member 4 OS=Arabid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top