EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: NEC1_NICLS (Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NECI PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.056e-28
Identity = 73/188 (38.83%), Postives = 107/188 (56.91%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            M+ D CVADL       G+PC      TA DF    +   G T +   + VT A V Q P +N LG+SLAR+D A GG+ P HTHP ASE++ V+ G +  GFI ++AN +  K + KG++ +FP+GL+HFQ N+G   A    +FNS  PG Q     LF  +  +   ++ QT  ++   V+++K+
Sbjct:   37 MLQDVCVADLHSKVKVNGFPC--KTNFTAADFSSLAISKPGATNNKFGSVVTTANVEQVPGLNTLGVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFI-TTANVLVSKKIIKGEVFVFPRGLVHFQKNNGEVPAAVISAFNSQLPGTQSIPITLFGASPPVPDDVLAQTFQINTEDVQQIKS 221          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: NEC1_NICPL (Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.624e-28
Identity = 73/188 (38.83%), Postives = 107/188 (56.91%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALF--ANNLSSQLVEQTTFLDDATVKRLKA 639
            M+ D CVADL       G+PC      TA DF    +   G T +   + VT A V Q P +N LG+SLAR+D A GG+ P HTHP ASE++ V+ G +  GFI ++AN +  K + KG++ +FP+GL+HFQ N+G   A    +FNS  PG Q     LF  +  +   ++ QT  ++   V+++K+
Sbjct:   37 MLQDVCVADLHSKVKVNGFPC--KTNFTAADFSSFAISKPGATNNKFGSKVTTANVEQVPGLNTLGVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFI-TTANVLVSKQITKGEVFVFPRGLVHFQKNNGKIPAAVVSAFNSQLPGTQSIPITLFGASPTVPDDVLAQTFQINIEDVQQIKS 221          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL117_ARATH (Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.624e-28
Identity = 75/191 (39.27%), Postives = 105/191 (54.97%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  D K      G  C  P    A+DF  SGL  AG T + + + VT   V Q P +N LG+SL R+D A  G  P HTHP A+EIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +   ++  ++ Q   LD   VK L+A
Sbjct:   27 LQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVQSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEA 217          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL115_ARATH (Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.624e-28
Identity = 75/191 (39.27%), Postives = 105/191 (54.97%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  D K      G  C  P    A+DF  SGL  AG T + + + VT   V Q P +N LG+SL R+D A  G  P HTHP A+EIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +   ++  ++ Q   LD   VK L+A
Sbjct:   27 LQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEA 217          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL119_ARATH (Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.126e-27
Identity = 75/191 (39.27%), Postives = 105/191 (54.97%), Query Frame = 1
Query:   85 VNDFCVA--DLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA--NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVA  D K      G  C  P    A+DF  SGL  AG T + + + VT   V Q P +N LG+SL R+D A  G  P HTHP A+EIL++V G +  GF+SS+   N ++ K L  GD+ +FP G++HFQVN G   A+ F   +S N G+      +F +   ++  ++ Q   LD   VK L+A
Sbjct:   27 LQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVQSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADIVFGSTPPINPDILAQAFQLDVNVVKDLEA 217          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL25_ARATH (Probable germin-like protein subfamily 2 member 5 OS=Arabidopsis thaliana GN=At5g26700 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.471e-27
Identity = 70/185 (37.84%), Postives = 101/185 (54.59%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLK 636
            M+ D CVADL  +    GY C     +T +DF F GL     T +   + VT A V + P +N LGLS++R+D A  G+ P H HP ASEI+ V+ G +  GF+ ++A  +  K L KGD+  FP+GL+HFQ N     A    +F+S  PG Q    +LF   L   ++ ++  L    VK++K
Sbjct:   24 MLQDVCVADLSNAVKVNGYTCKDSTQITPEDFYFKGLANIAATNTSTGSVVTGANVEKLPGLNTLGLSMSRIDYAPNGLNPPHVHPRASEIIFVLEGQLYVGFV-TTAGKLIAKNLNKGDVFTFPKGLIHFQKNIANSPASVLAAFDSQLPGTQSLVASLF-GALPDDILAKSFQLKHKQVKKIK 206          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL14_ORYSJ (Germin-like protein 1-4 OS=Oryza sativa subsp. japonica GN=Os01g0952100 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.471e-27
Identity = 73/199 (36.68%), Postives = 114/199 (57.29%), Query Frame = 1
Query:   82 MVNDFCVADLKLSDSPA---GYPCVPPAMVTADDFVFSGLGVAGNTTS--IINAAVTPAFVAQFPAVNGLGLSLARLDLAK-GGVIPIHTHPAASEILLVVHGCITAGFISSSA----NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN---LSSQLVEQTTFLDDATVKRLKA 639
            M+ D CVAD K    P    G+PC P A VTA+DF F GLG   +  S   + +AVT A V + P +N LG+S+AR+D A  GG  P H+HP A+EIL V  G +  GF+ ++A    + +  + + KG + +FP+GLLH++ + G   A+   +F+S  PG Q    ALF ++   + + ++ +   +D   V+ +K+
Sbjct:   32 MLQDICVADYKSLQGPLRVNGFPCKPEANVTAEDFFFPGLGKPADVYSGNPMGSAVTAATVERIPGLNTLGVSMARVDYAPWGGANPPHSHPRATEILFVADGLLEVGFVVATAAPASSRLITRVVPKGGVFVFPRGLLHYERSVGEKPAVAISAFDSQLPGTQAAADALFGSSSPAVPTDVLARAFQVDGGVVENIKS 230          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL12_ARATH (Putative germin-like protein subfamily 1 member 2 OS=Arabidopsis thaliana GN=At3g04150 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.471e-27
Identity = 71/196 (36.22%), Postives = 113/196 (57.65%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPA-GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS--ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILGGTG 657
            + D+CVA    +     G  C  P +VTA+DF +SGL + GNT++ + A+VT   V + P +N LG+++ARLD A GG +P H HP AS+I+LV+ G ++ GF+SS+    T++ K L  GD+  FP GL+ F  N+G   A+      S +PG+     A+F +N  +  +L+ +   LD   V+ ++ +    G
Sbjct:   30 LQDYCVATNGTNRVFVNGKFCKDPKLVTANDFFYSGLNIPGNTSNRLGASVTDVDVRRIPGLNTLGIAIARLDFAPGGQLPPHIHPRASQIILVLKGQLSVGFVSSNDYNYTLFSKILYPGDVFAFPIGLVQFHANTGKTHAVAIGVVGSQDPGVIPIGDAVFGSNPLIDPKLLAKAFALDVNIVRHVQRVFSSEG 225          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL111_ARATH (Germin-like protein subfamily 1 member 11 OS=Arabidopsis thaliana GN=At5g38940 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.471e-27
Identity = 68/168 (40.48%), Postives = 97/168 (57.74%), Query Frame = 1
Query:   79 AMVNDFCVADLKLSDSPA--GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN 573
            + + DFCV+    ++     G  C  P +VTADDF FSGL  A   TS + + VT   V     +N LG+SL R+D A  G  P HTHP A+EIL+V  G +  GF++S+  N ++ K L +GD+ +FP+GL+HFQ N G   A+ F + +S NPG+      +F  N
Sbjct:   28 SQLQDFCVSANTSANGVFVNGKFCKDPKLVTADDFFFSGLQTARPITSPVGSTVTAVNVNNLLGLNTLGISLVRIDYAVNGQNPPHTHPRATEILVVEQGTLLVGFVTSNPDNRLFSKVLNEGDVFVFPEGLIHFQANIGKAPAVAFAALSSQNPGVITIANTVFGAN 195          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GER2_WHEAT (Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.277e-27
Identity = 71/167 (42.51%), Postives = 99/167 (59.28%), Query Frame = 1
Query:   85 VNDFCVADLK-LSDSPAGYPCVPPAMVTADDFVFSG-LGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISS--SANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN 573
            + DFCVADL   + S  G+ C P +    DDF+FS  L  AGNT++   +AVT   VA++P  N LG+S+ R+D A GG  P H HP A+EI +V+ G +  G + S  S N +Y + ++ G+  + P+GL+HFQ N G   A   VSFNS NPG+      LF +N
Sbjct:   29 LQDFCVADLDGKAVSVNGHTCKPMSEA-GDDFLFSSKLAKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGIVMKGELLVGILGSLDSGNKLYSRVVRAGETFLIPRGLMHFQFNVGKTEASMVVSFNSQNPGIVFVPLTLFGSN 194          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
NEC1_NICLS5.056e-2838.83Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana s... [more]
NEC1_NICPL8.624e-2838.83Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE... [more]
GL117_ARATH8.624e-2839.27Germin-like protein subfamily 1 member 17 OS=Arabi... [more]
GL115_ARATH8.624e-2839.27Germin-like protein subfamily 1 member 15 OS=Arabi... [more]
GL119_ARATH1.126e-2739.27Germin-like protein subfamily 1 member 19 OS=Arabi... [more]
GL25_ARATH1.471e-2737.84Probable germin-like protein subfamily 2 member 5 ... [more]
GL14_ORYSJ1.471e-2736.68Germin-like protein 1-4 OS=Oryza sativa subsp. jap... [more]
GL12_ARATH1.471e-2736.22Putative germin-like protein subfamily 1 member 2 ... [more]
GL111_ARATH1.471e-2740.48Germin-like protein subfamily 1 member 11 OS=Arabi... [more]
GER2_WHEAT3.277e-2742.51Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top