EY659621

Overview
NameEY659621
Unique NameEY659621
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length888
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7118 contig Csv1_Contig7118:23..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL34_ORYSJ (Putative germin-like protein 3-4 OS=Oryza sativa subsp. japonica GN=Os03g0693800 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.124e-26
Identity = 71/195 (36.41%), Postives = 107/195 (54.87%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSG-LGVAGNTTSIINAA-VTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISS--SANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKAILGG 651
            + DFCVADL    +  G+ C  PA    D+F+FS  +   G+  +  N + VT   VA++P VN LG+S+ R+D A GG  P H HP A+E+ +V+ G +  G I +    N  Y K ++ G+  + P+GL+HFQ N G   A   VSFNS NPG+      LF +N  + + ++ +   +D   V+ LK+   G
Sbjct:   34 LQDFCVADLDSKVTVNGHAC-KPASAAGDEFLFSSKIATGGDVNANPNGSNVTELDVAEWPGVNTLGVSMNRVDFAPGGTNPPHVHPRATEVGIVLRGELLVGIIGTLDMGNRYYSKVVRAGETFVIPRGLMHFQFNVGKTEATMVVSFNSQNPGIVFVPLTLFGSNPPIPTPVLVKALRVDTGVVELLKSKFTG 227          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL32_ARATH (Germin-like protein subfamily 3 member 2 OS=Arabidopsis thaliana GN=At3g10080 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.124e-26
Identity = 70/191 (36.65%), Postives = 103/191 (53.93%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSP-------AGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANNLSSQLVEQTTFLDDATVKRLK 636
            + DFC+   K   SP          PC   + VT +DFVFSGL  AGN T     A  P     FP +N LG+S  R DL  G + P H HP A+E+  +V G + +GF+ S+ N VY K +++G++M++P+GL+HFQ+N G   A      NS NPG+Q     +F + ++ +L+ +   L    +  LK
Sbjct:   30 IQDFCIP--KPVTSPYHDHHFSTNLPCKNSSEVTTEDFVFSGLKTAGNFTET-GFATVPVGPENFPGLNTLGISFVRADLKPGSINPPHYHPRATEVAHLVKGRVYSGFVDSN-NKVYAKVMEEGEMMVYPKGLVHFQMNVGDVTATIVGGLNSQNPGIQKIPSVVFGSGINEELLMKAFGLSLKQIGTLK 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL85_ORYSJ (Germin-like protein 8-5 OS=Oryza sativa subsp. japonica GN=Os08g0189400 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.623e-26
Identity = 69/189 (36.51%), Postives = 106/189 (56.08%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD+       G+ C+ P  V AD F  +        T+ + + VT   V Q P +N LG+S+AR+D A  G  P HTHP A+EIL V+ G +  GF++S+  NT++ K L KGD+ +FPQGL+HFQ N      A+   + +S NPG      A+F +   +S +++ +   ++  T+  L+A
Sbjct:   28 LQDFCVADMHSPVRVNGFACLNPMEVNADHFFKAAKLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNNTLFSKVLNKGDVFVFPQGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPISDEVLAKAFQVEKGTIDWLQA 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL84_ORYSJ (Germin-like protein 8-4 OS=Oryza sativa subsp. japonica GN=GER1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.732e-26
Identity = 64/164 (39.02%), Postives = 97/164 (59.15%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSG-LGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSANTVYVKTLKKGDIMIFPQGLLHFQVNSGAD-GALGFVSFNSPNPGLQITDFALFAN 570
            + DFCVAD+K      G+PC  P  V +DDF  +    +  +T + + + VT   V  FP +N LG+SLAR+D A  GV P H HP A+E+L V+ G +  GF++S+ N ++ K + KGD  +FP+ ++HFQ+N   +  A+   S NS NPG+     A+F +
Sbjct:   29 LQDFCVADMKSPVRVNGFPCKNPMEVNSDDFFNAAKFDMPRSTMNKVGSNVTNLNVLNFPGLNTLGISLARIDYAPLGVNPPHIHPRATELLTVLEGTLYVGFVTSNPNRLFSKVVHKGDTFVFPKAMIHFQMNLDHNKPAVAQSSLNSQNPGVITIASAVFGS 192          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL89_ORYSJ (Germin-like protein 8-9 OS=Oryza sativa subsp. japonica GN=Os08g0189850 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.180e-26
Identity = 69/189 (36.51%), Postives = 106/189 (56.08%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD        G+ C+ P  VTAD F  + +      T+ + + VT   V Q P +N LG+S+AR+D A  G  P HTHP A+EIL V+ G +  GF++S+  NT++ K L KGD+ +FP GL+HFQ N      A+   + +S NPG+     A+F +   +S +++ +   +   T+  L+A
Sbjct:   28 LQDFCVADKHSPVLVNGFACLDPKYVTADHFFKAAMLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLHVGFVTSNPNNTLFSKVLNKGDVFVFPVGLIHFQFNPNPHQPAVAIAALSSQNPGVITIANAVFGSKPPISDEVLAKAFQVGKGTIDWLQA 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL87_ORYSJ (Germin-like protein 8-7 OS=Oryza sativa subsp. japonica GN=GER6 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.072e-26
Identity = 68/189 (35.98%), Postives = 105/189 (55.56%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD        G+ C+ P  V AD F  + +      T+ + + VT   V Q P +N LG+S+AR+D A  G  P HTHP A+EIL V+ G +  GF++S+  NT++ K L KGD+ +FP+GL+HFQ N      A+   + +S NPG      A+F +   +S  ++ +   ++  T+  L+A
Sbjct:   29 LQDFCVADKHSPVLVNGFACLDPKYVNADHFFKAAMLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNPNNTLFSKVLNKGDVFVFPEGLIHFQFNPNPHQPAVALAALSSQNPGAITIANAVFGSKPPISDDILAKAFQVEKGTIDWLQA 217          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL86_ORYSJ (Germin-like protein 8-6 OS=Oryza sativa subsp. japonica GN=Os08g0189500 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.072e-26
Identity = 69/189 (36.51%), Postives = 106/189 (56.08%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD        G+ C+ P  V AD F  + +      T+ + + VT   V Q P +N LG+S+AR+D A  G  P HTHP A+EIL V+ G +  GF++S+  NT++ K LKKGD+ +FP GL+HFQ N      A+   + +S NPG      A+F +   +S +++ +   ++  T+  L+A
Sbjct:   29 LQDFCVADEHSPVLVNGFACLDPKHVNADHFFKAAMLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGQNPPHTHPRATEILTVLEGTLYVGFVTSNPNNTLFSKVLKKGDVFVFPVGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPISDEVLAKAFQVEKGTIDWLQA 217          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL810_ORYSJ (Germin-like protein 8-10 OS=Oryza sativa subsp. japonica GN=GLP2 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 8.072e-26
Identity = 68/189 (35.98%), Postives = 106/189 (56.08%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVAD+       G+ C+ P  V AD F  + +      T+ + + VT   V Q P +N LG+S+AR+D A  G  P HTHP A+EIL V+ G +  GF++S+  NT++ K L KGD+ +FP+GL+HFQ N      A+   + +S NPG      A+F +   +S  ++ +   ++  T+  L+A
Sbjct:   28 LQDFCVADMHSPVLVNGFACLDPKYVNADHFFKAAMLDTPRKTNKVGSNVTLINVMQIPGLNTLGISIARIDYAPLGENPPHTHPRATEILTVLEGTLYVGFVTSNPNNTLFSKVLNKGDVFVFPEGLIHFQFNPNPHQPAVAIAALSSQNPGAITIANAVFGSKPPISDIVLAKAFQVEKGTIDWLQA 216          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL19_ARATH (Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.054e-25
Identity = 67/166 (40.36%), Postives = 92/166 (55.42%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPA--GYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSS-ANTVYVKTLKKGDIMIFPQGLLHFQVNSGADGALGFVSFNSPNPGLQITDFALFANN 573
            + DFCV     +D     G  C  P +VT +DF F+GL  A        + VT   V   P +N LG+SL R+D    G  P HTHP ASE+L V  G +  GF++S+  N ++ KTL +GD+ +FPQGL+HFQVN G   A+ F   +S NPG+      +F +N
Sbjct:   28 LQDFCVGVNTPADGVFVNGKFCKDPKLVTVEDFFFTGLHEARPPNPKTGSNVTAVNVNNLPGLNTLGISLVRIDYGVYGQNPPHTHPRASEVLYVAVGTLFVGFVTSNPENRLFSKTLYEGDVFVFPQGLIHFQVNVGKYPAVAFAGLSSQNPGVITIADTVFGSN 193          
BLAST of EY659621 vs. ExPASy Swiss-Prot
Match: GL82_ORYSJ (Germin-like protein 8-2 OS=Oryza sativa subsp. japonica GN=GER3 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.377e-25
Identity = 70/190 (36.84%), Postives = 106/190 (55.79%), Query Frame = 1
Query:   85 VNDFCVADLKLSDSPAGYPCVPPAMVTADDFVFSG-LGVAGNTTSIINAAVTPAFVAQFPAVNGLGLSLARLDLAKGGVIPIHTHPAASEILLVVHGCITAGFISSSA-NTVYVKTLKKGDIMIFPQGLLHFQVNSGA-DGALGFVSFNSPNPGLQITDFALFANN--LSSQLVEQTTFLDDATVKRLKA 639
            + DFCVADL       G+ C  P   +ADDF  +  L    +T + + + VT   V Q P +N LG+S+ARLD A  G+ P HTHP A+EI  V+ G +  GF++S+  N +  K L KGD+ +FP+GL+HFQ N      A+   + +S NPG+     A+F +N  +S  ++ +   +D   +  L+A
Sbjct:   30 LQDFCVADLNSPVRVNGFVCKNPMNASADDFFKAAMLDKPRDTNNKVGSNVTLVNVLQLPGLNTLGISIARLDFAPLGLNPPHTHPRATEIFTVLEGTLYVGFVTSNPDNRLLSKVLNKGDVFVFPEGLIHFQFNPNPHKPAVAIAALSSQNPGVITIANAVFGSNPPISDDILMKAFQVDKKIIDLLQA 219          
The following BLAST results are available for this feature:
BLAST of EY659621 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
GL34_ORYSJ2.124e-2636.41Putative germin-like protein 3-4 OS=Oryza sativa s... [more]
GL32_ARATH2.124e-2636.65Germin-like protein subfamily 3 member 2 OS=Arabid... [more]
GL85_ORYSJ3.623e-2636.51Germin-like protein 8-5 OS=Oryza sativa subsp. jap... [more]
GL84_ORYSJ4.732e-2639.02Germin-like protein 8-4 OS=Oryza sativa subsp. jap... [more]
GL89_ORYSJ6.180e-2636.51Germin-like protein 8-9 OS=Oryza sativa subsp. jap... [more]
GL87_ORYSJ8.072e-2635.98Germin-like protein 8-7 OS=Oryza sativa subsp. jap... [more]
GL86_ORYSJ8.072e-2636.51Germin-like protein 8-6 OS=Oryza sativa subsp. jap... [more]
GL810_ORYSJ8.072e-2635.98Germin-like protein 8-10 OS=Oryza sativa subsp. ja... [more]
GL19_ARATH1.054e-2540.36Putative germin-like protein subfamily 1 member 9 ... [more]
GL82_ORYSJ1.377e-2536.84Germin-like protein 8-2 OS=Oryza sativa subsp. jap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-013-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659621 ID=EY659621|Name=EY659621|organism=Citrus sinensis|type=EST|length=888bp
AAATAACTTCACTAAATATTAGTCAAAATGCTTCACATTCTCTTCTTCTT
CCTTGCTTTCGTATCCTCTTCCTCCAATGCTATGGTTAACGACTTCTGCG
TCGCTGACCTAAAGCTGTCGGATAGTCCCGCCGGCTATCCTTGCGTGCCC
CCCGCTATGGTTACCGCTGACGACTTCGTATTTTCGGGCCTCGGCGTGGC
CGGAAACACCACGAGCATTATCAACGCGGCAGTGACACCTGCATTTGTAG
CTCAATTTCCGGCCGTGAATGGGCTCGGACTCTCCTTGGCACGCCTAGAT
CTTGCAAAGGGTGGCGTAATCCCAATCCACACTCATCCAGCTGCTTCCGA
AATCCTTCTTGTTGTGCATGGCTGCATAACTGCCGGGTTCATTTCCTCTT
CAGCTAACACTGTTTACGTAAAGACGCTTAAGAAGGGAGATATCATGATC
TTTCCACAAGGGTTGTTGCATTTTCAAGTAAATTCCGGTGCGGACGGAGC
CCTCGGTTTTGTTAGCTTCAACAGCCCGAATCCTGGACTCCAAATCACCG
ATTTCGCCTTATTTGCTAACAACTTGTCTTCCCAATTGGTGGAGCAGACC
ACTTTCCTTGACGATGCTACGGTGAAGAGGCTCAAGGCTATCCTTGGTGG
CACCGGCTAGGCTTATTAGNTACCACATTCTTCATTTGTAGGTTTGAGTT
CTTTATTTCATTTAGTTGCCTATGTTCTTGATCGTTGGAATTCACGAGTT
AGTATTTTCTGGTCTCACTGCCCCTATCTTTTCTTCTGAATAATAAAATG
CCTCTCATCATGCAAAAAAAAAAAAATAATGGCCGNCCGTCTAGAAGTAT
CAAACTTACGTACCGCTGCATGCGGAGTTATAACTCTT
back to top