EY659523
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY659523 vs. ExPASy Swiss-Prot
Match: RK33_ANGEV (50S ribosomal protein L33, chloroplastic OS=Angiopteris evecta GN=rpl33 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 2.016e-11 Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 3 Query: 291 MANGKDVLLRVIVECTMRVRNGANDESRGVSIYITQNNRHSTPMRLELIKFCPYCYKHTLHGEITK 488 MA KDV + + +EC RN ++ GVS Y T+ N+ +TP RLEL KFCPYC +HT+H E+ K Sbjct: 1 MAKSKDVRVTITLECISCDRNNSDKRFPGVSRYTTRKNQRNTPTRLELKKFCPYCSEHTIHRELKK 66
BLAST of EY659523 vs. ExPASy Swiss-Prot
Match: RK33_MARPO (50S ribosomal protein L33, chloroplastic OS=Marchantia polymorpha GN=rpl33 PE=3 SV=3) HSP 1 Score: 68.5514 bits (166), Expect = 5.865e-11 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 3 Query: 291 MANGKDVLLRVIVECTMRVRNGANDESR--GVSIYITQNNRHSTPMRLELIKFCPYCYKHTLHGEITK 488 MA KD+ + + +EC + NDE R G+S Y TQ NR +TP+RLEL KFC YC KHT+H EI K Sbjct: 1 MAKSKDIRVTINLEC---INCAQNDEKRKKGISRYTTQKNRRNTPIRLELKKFCCYCNKHTIHKEIKK 65 The following BLAST results are available for this feature:
BLAST of EY659523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659523 ID=EY659523; Name=EY659523; organism=Citrus sinensis; type=EST; length=916bpback to top |