EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_ARTSX (Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 194/220 (88.18%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SS+S+EK+YELPDGQIITIG ERFRCPE LFQPS +GME  GIHET YNSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEIT LAPSSMKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  108 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYTFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQIITIGNERFRCPEALFQPSFLGMETCGIHETAYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITMLAPSSMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 327          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_CAEEL (Actin-1/3 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 6.855e-110
Identity = 190/220 (86.36%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+IT+G ERFRCPE +FQPS +GME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTM_HELTB (Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.169e-109
Identity = 191/220 (86.82%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL Y ALD+EQE+ TA +SSS+EK+YELPDGQ+ITIG ERFRCPE LFQP+ IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG++M+PGIADRM KEITALAPSSMKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYTALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPETLFQPAFIGMESAGIHETTYNSIMKCDIDIRKDLYANTVLSGGTSMYPGIADRMQKEITALAPSSMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTM_APLCA (Actin, muscle OS=Aplysia californica PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.169e-109
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD L KILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQP L+GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEIT+LAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLSKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPILLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_LIMPO (Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.169e-109
Identity = 193/220 (87.73%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE +FQPS +GMEA GIHETT+NSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEI ALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEHEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEACGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEIGALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT5_CHICK (Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.169e-109
Identity = 191/220 (86.82%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE +FQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEAIFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_SCHMA (Actin-1 OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.169e-109
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD +MKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSS++EK+YELPDGQ+ITIG ERFRCPE LFQPS +GMEA+GIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGIADRM KEI+ALAPS+MKIK+VAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEASGIHETTYNSIMKCDVDIRKDLYSNTVLSGGSTMYPGIADRMQKEISALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTD_STRPU (Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.527e-109
Identity = 193/220 (87.73%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQP+ +GME+AGIHET YNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRAPEALFQPAFLGMESAGIHETCYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_CRIGR (Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.527e-109
Identity = 191/220 (86.82%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQ+MWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQEMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_STRFN (Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.527e-109
Identity = 193/220 (87.73%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQP+ +GME+AGIHET YNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRAPEALFQPAFLGMESAGIHETCYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT3_ARTSX6.855e-11088.18Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV... [more]
ACT1_CAEEL6.855e-11086.36Actin-1/3 OS=Caenorhabditis elegans GN=act-1 PE=1 ... [more]
ACTM_HELTB1.169e-10986.82Actin, cytoskeletal OS=Heliocidaris tuberculata PE... [more]
ACTM_APLCA1.169e-10987.73Actin, muscle OS=Aplysia californica PE=2 SV=1[more]
ACTA_LIMPO1.169e-10987.73Actin, acrosomal process isoform OS=Limulus polyph... [more]
ACT5_CHICK1.169e-10986.82Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV... [more]
ACT1_SCHMA1.169e-10987.27Actin-1 OS=Schistosoma mansoni PE=2 SV=1[more]
ACTD_STRPU1.527e-10987.73Actin, cytoskeletal 2B OS=Strongylocentrotus purpu... [more]
ACTB_CRIGR1.527e-10986.82Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB... [more]
ACT2_STRFN1.527e-10987.73Actin-15B OS=Strongylocentrotus franciscanus PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top