EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_ARATH (Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 4.149e-115
Identity = 201/220 (91.36%), Postives = 215/220 (97.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEG++LPHAILRLDLAGRDLTD LMKILTERGYMFTTTAEREIVRD+KEKL++VA+DYEQE+ET+K+SSS+EKNYELPDGQ+ITIGAERFRCPEVLFQPS +GMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:  158 GDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT7_SOLTU (Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.207e-114
Identity = 203/220 (92.27%), Postives = 213/220 (96.82%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLT+ L KILTERGY FTT+AE+EIVRDMKEKLAY+ALD+EQEL+  KSSSSVEKN+ELPDGQ+ITIGAERFRCPEVLFQPS IGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K E+DESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTEHLAKILTERGYSFTTSAEKEIVRDMKEKLAYIALDFEQELDMVKSSSSVEKNFELPDGQVITIGAERFRCPEVLFQPSTIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEFDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT12_ARATH (Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.207e-114
Identity = 203/220 (92.27%), Postives = 213/220 (96.82%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRDMKEKL+Y+ALDYEQELET+K+SSSVEK++ELPDGQ+ITIGAERFRCPEVLFQPS+IGME  GIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GI DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_COLSC (Actin OS=Coleochaete scutata PE=2 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 2.059e-114
Identity = 200/220 (90.91%), Postives = 216/220 (98.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD +MKILTERGY FTTTAEREIVRD+KEKLAYVALD+EQE++TA++SSS+EK+YELPDGQ+ITIG+ERFRCPEVLF P+LIGME+AGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYAFTTTAEREIVRDIKEKLAYVALDFEQEMQTAQNSSSLEKSYELPDGQVITIGSERFRCPEVLFNPALIGMESAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT4_ARATH (Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 3.512e-114
Identity = 202/220 (91.82%), Postives = 213/220 (96.82%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRDMKEKL+Y+ALD+EQELET+K+SSSVEK++ELPDGQ+ITIGAERFRCPEVLFQPS+IGME  GIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GI DRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDFEQELETSKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT7_ORYSJ (Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 5.991e-114
Identity = 201/220 (91.36%), Postives = 209/220 (95.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEG+ LPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKLAYVALDYEQEL+TA+SSSS+EK+YELPDGQ+ITIGAERFRCPEVLFQPS IGMEA GIHE TYNSIMKCDVDIRKDLYGN+VLSGGSTMFPGI DRMSKEITALAP SMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF
Sbjct:  157 GDGVSHTVPIYEGFTLPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELDTARSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHEATYNSIMKCDVDIRKDLYGNVVLSGGSTMFPGIGDRMSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT7_ORYSI (Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 5.991e-114
Identity = 201/220 (91.36%), Postives = 209/220 (95.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEG+ LPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKLAYVALDYEQEL+TA+SSSS+EK+YELPDGQ+ITIGAERFRCPEVLFQPS IGMEA GIHE TYNSIMKCDVDIRKDLYGN+VLSGGSTMFPGI DRMSKEITALAP SMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVH KCF
Sbjct:  157 GDGVSHTVPIYEGFTLPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELDTARSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHEATYNSIMKCDVDIRKDLYGNVVLSGGSTMFPGIGDRMSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT6_SOLTU (Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2)

HSP 1 Score: 410.609 bits (1054), Expect = 5.991e-114
Identity = 201/220 (91.36%), Postives = 213/220 (96.82%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLT+ ++KILTERGY FTTTAE+EIVRD+KEKLAY+ALD+EQELET K+ S+VEKNYELPDGQ+ITIGAERFRCPEVL+QPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGN VLSGGSTMFPGIADRMSKEI ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYMVKILTERGYSFTTTAEKEIVRDVKEKLAYLALDFEQELETTKTGSAVEKNYELPDGQVITIGAERFRCPEVLYQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNHVLSGGSTMFPGIADRMSKEIQALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_DAUCA (Actin-1 OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 5.072e-113
Identity = 204/220 (92.73%), Postives = 211/220 (95.91%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYS-VWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTE+     TTAEREIVRDMKEKLAYVALDYEQELETAK  S+VEKNYELPDGQ+ITIGAERFRCP+VLFQPS+IGME+AGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYS +WIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTEKSICHYTTAEREIVRDMKEKLAYVALDYEQELETAKRRSAVEKNYELPDGQVITIGAERFRCPQVLFQPSMIGMESAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSDLWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_PHYPO (Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2)

HSP 1 Score: 407.142 bits (1045), Expect = 6.624e-113
Identity = 196/220 (89.09%), Postives = 212/220 (96.36%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKLAYVALD+EQE++TA SSS++EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+AGIHETTYNSIMKCDVDIRKDLYGN+VLSGG+TMFPGIADRM KE+TALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT2_ARATH4.149e-11591.36Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1[more]
ACT7_SOLTU1.207e-11492.27Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1[more]
ACT12_ARATH1.207e-11492.27Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=... [more]
ACT_COLSC2.059e-11490.91Actin OS=Coleochaete scutata PE=2 SV=1[more]
ACT4_ARATH3.512e-11491.82Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1[more]
ACT7_ORYSJ5.991e-11491.36Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE... [more]
ACT7_ORYSI5.991e-11491.36Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3... [more]
ACT6_SOLTU5.991e-11491.36Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2[more]
ACT1_DAUCA5.072e-11392.73Actin-1 OS=Daucus carota PE=2 SV=1[more]
ACTA_PHYPO6.624e-11389.09Actin, plasmodial isoform OS=Physarum polycephalum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top