EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_ORYSJ (Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.990e-117
Identity = 208/220 (94.55%), Postives = 217/220 (98.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTT+AEREIVRD+KEKLAYVALDYEQELETAKSSSSVEK+YELPDGQ+ITIGAERFRCPEV+FQPSLIGMEA GIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVMFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_ORYSI (Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.990e-117
Identity = 208/220 (94.55%), Postives = 217/220 (98.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTT+AEREIVRD+KEKLAYVALDYEQELETAKSSSSVEK+YELPDGQ+ITIGAERFRCPEV+FQPSLIGMEA GIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIS+ EY+ESGP+IVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEKLAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVMFQPSLIGMEAPGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISRAEYEESGPAIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_ORYSJ (Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.990e-117
Identity = 207/220 (94.09%), Postives = 216/220 (98.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRDMKEKL+Y+ALDY+QE+ETAK+SSSVEK+YELPDGQ+ITIGAERFRCPEVLFQPS IGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_ORYSI (Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.990e-117
Identity = 207/220 (94.09%), Postives = 216/220 (98.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRDMKEKL+Y+ALDY+QE+ETAK+SSSVEK+YELPDGQ+ITIGAERFRCPEVLFQPS IGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_SOLTU (Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 5.789e-117
Identity = 206/220 (93.64%), Postives = 217/220 (98.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL+Y+ALD+EQELET+K+SSSVEK+YELPDGQ+ITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFPGIADRMSKE+TALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEKLSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT11_ARATH (Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.684e-116
Identity = 205/220 (93.18%), Postives = 215/220 (97.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRD+KEKLAY+ALDYEQE+ETA +SSSVEK+YELPDGQ+ITIG ERFRCPEVLFQPSL+GMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEKLAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_TOBAC (Actin OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.200e-116
Identity = 205/220 (93.18%), Postives = 216/220 (98.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL+Y+ALD+EQE+ET+K+SSSVEK+YELPDGQ+ITIGAERFRCPEVLFQPS+IGMEAAGIHETTYNSIMKCDVDIRKDLYG IVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEKLSYIALDFEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYGKIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_SOYBN (Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2)

HSP 1 Score: 418.313 bits (1074), Expect = 2.873e-116
Identity = 209/220 (95.00%), Postives = 216/220 (98.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEG ALPHAILRLDLAGRDLTD LMKILTERGYMFTT+AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEK++ELPDGQ+ITIGAERFRCP++LFQPS+I MEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMF GIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGDALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKSHELPDGQVITIGAERFRCPKILFQPSMIEMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFLGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_PEA (Actin-3 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.862e-115
Identity = 204/220 (92.73%), Postives = 213/220 (96.82%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEKLAY+ALDYEQELETAK+SS+VEK YELPDGQ+ITIGAERFRCPEV  QPS+IGME+ GIHETT+NSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTERGYTFTTSAEREIVRDMKEKLAYIALDYEQELETAKTSSAVEKTYELPDGQVITIGAERFRCPEVTVQPSMIGMESPGIHETTFNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT8_ARATH (Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2)

HSP 1 Score: 414.461 bits (1064), Expect = 4.149e-115
Identity = 201/220 (91.36%), Postives = 215/220 (97.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEG++LPHAILRLDLAGRDLTD LMKILTERGYMFTTTAEREIVRD+KEKL++VA+DYEQE+ET+K+SSS+EKNYELPDGQ+ITIGAERFRCPEVLFQPS +GMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:  158 GDGVSHTVPIYEGFSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTTAEREIVRDIKEKLSFVAVDYEQEMETSKTSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSFVGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDEAGPGIVHRKCF 377          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT2_ORYSJ1.990e-11794.55Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE... [more]
ACT2_ORYSI1.990e-11794.55Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3... [more]
ACT1_ORYSJ1.990e-11794.09Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE... [more]
ACT1_ORYSI1.990e-11794.09Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2... [more]
ACT3_SOLTU5.789e-11793.64Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1[more]
ACT11_ARATH1.684e-11693.18Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=... [more]
ACT1_TOBAC2.200e-11693.18Actin OS=Nicotiana tabacum PE=3 SV=1[more]
ACT3_SOYBN2.873e-11695.00Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2[more]
ACT3_PEA1.862e-11592.73Actin-3 OS=Pisum sativum PE=2 SV=1[more]
ACT8_ARATH4.149e-11591.36Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top