EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_SOYBN (Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2)

HSP 1 Score: 393.275 bits (1009), Expect = 9.898e-109
Identity = 192/220 (87.27%), Postives = 209/220 (95.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILT+RGY FTT+A+R IVRDMKEKLAY+ALD EQELET+++SSSVEK+YELPDGQ+ITIGAERF CP VL+QPS++GMEA+GIHETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFP IADRMSKEI+ALAPSSMKIKVVAP ERK+ VWIGGSILASLSTFQQMWI K EYDESGPSIVH+KCF
Sbjct:  158 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTQRGYSFTTSAQRGIVRDMKEKLAYIALDCEQELETSETSSSVEKSYELPDGQVITIGAERFGCPGVLYQPSMVGMEASGIHETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPSIADRMSKEISALAPSSMKIKVVAPSERKFGVWIGGSILASLSTFQQMWIXKAEYDESGPSIVHKKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_PODCA (Actin-1/2 OS=Podocoryne carnea GN=ACTIA PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 9.898e-109
Identity = 190/220 (86.36%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAI+RLDLAGRDLTD +MKILTERGY FTTTAEREIVRD+KEKLAYVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQP+ +GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEI++LAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRDPEALFQPAFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEISSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_BRUMA (Actin OS=Brugia malayi PE=1 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 190/220 (86.36%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H+VPIYEGYALPHAILRLDLAGRDLTD LMKILT+RGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TM PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVTHSVPIYEGYALPHAILRLDLAGRDLTDYLMKILTDRGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESTGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMVPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTN_STYCL (Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 190/220 (86.36%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SS+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  159 GDGVSHNVPIYEGYALPHAIARLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTM_STYCL (Actin, muscle OS=Styela clava PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 190/220 (86.36%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SS+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  159 GDGVSHNVPIYEGYALPHAIARLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_BOSMU (Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 190/220 (86.36%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+  A SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TM+PGIA+RM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAIAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIANRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT6_DIPDE (Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 188/220 (85.45%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+IT+G ERFRCPE LFQPS +G+E+ GIHET YNSIMKCD+DIRKDLY NIVLSGGSTM+PGIADRM+KE+T+LAPSSMKIK++APPERKYSVWIGGSIL SLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  154 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGLESVGIHETCYNSIMKCDLDIRKDLYSNIVLSGGSTMYPGIADRMNKELTSLAPSSMKIKIIAPPERKYSVWIGGSILGSLSTFQQMWITKQEYDESGPSIVHRKCF 373          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT5_DROME (Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 189/220 (85.91%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +S+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHET YNSIMKCDVDIRKDLY NIV+SGG+TM+PGIADRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_MOLOC (Actin, muscle-type OS=Molgula oculata PE=3 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 188/220 (85.45%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE +FQPS IGME++G+HETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  159 GDGVSHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPETMFQPSFIGMESSGVHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDESGPSIVHRKCF 378          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_HALRO (Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.293e-108
Identity = 190/220 (86.36%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SS+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  159 GDGVSHNVPIYEGYALPHAIARLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 378          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT1_SOYBN9.898e-10987.27Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2[more]
ACT1_PODCA9.898e-10986.36Actin-1/2 OS=Podocoryne carnea GN=ACTIA PE=2 SV=1[more]
ACT_BRUMA1.293e-10886.36Actin OS=Brugia malayi PE=1 SV=1[more]
ACTN_STYCL1.293e-10886.36Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1[more]
ACTM_STYCL1.293e-10886.36Actin, muscle OS=Styela clava PE=2 SV=1[more]
ACTB_BOSMU1.293e-10886.36Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACT... [more]
ACT6_DIPDE1.293e-10885.45Actin-6 (Fragment) OS=Diphyllobothrium dendriticum... [more]
ACT5_DROME1.293e-10885.91Actin-87E OS=Drosophila melanogaster GN=Act87E PE=... [more]
ACT2_MOLOC1.293e-10885.45Actin, muscle-type OS=Molgula oculata PE=3 SV=1[more]
ACT2_HALRO1.293e-10886.36Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top