EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_RAT (Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_MOUSE (Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_HUMAN (Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_CHICK (Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_BOVIN (Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_RAT (Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_RABIT (Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_MOUSE (Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_HUMAN (Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTA_BOVIN (Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 2.205e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACTC_RAT2.205e-10885.91Actin, alpha cardiac muscle 1 OS=Rattus norvegicus... [more]
ACTC_MOUSE2.205e-10885.91Actin, alpha cardiac muscle 1 OS=Mus musculus GN=A... [more]
ACTC_HUMAN2.205e-10885.91Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=A... [more]
ACTC_CHICK2.205e-10885.91Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=... [more]
ACTC_BOVIN2.205e-10885.91Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACT... [more]
ACTA_RAT2.205e-10885.91Actin, aortic smooth muscle OS=Rattus norvegicus G... [more]
ACTA_RABIT2.205e-10885.91Actin, aortic smooth muscle OS=Oryctolagus cunicul... [more]
ACTA_MOUSE2.205e-10885.91Actin, aortic smooth muscle OS=Mus musculus GN=Act... [more]
ACTA_HUMAN2.205e-10885.91Actin, aortic smooth muscle OS=Homo sapiens GN=ACT... [more]
ACTA_BOVIN2.205e-10885.91Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top