EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_MANSE (Actin, muscle OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 188/220 (85.45%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +S+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHET YNSIMKCDVDIRKDLY N V+SGG+TM+PGIADRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTSB_TAKRU (Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMGTAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTM_CIOSA (Actin, muscle OS=Ciona savignyi PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SS+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF
Sbjct:  159 GDGVSHNVPIYEGYALPHAIARLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSTSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 378          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_DROME (Actin-57B OS=Drosophila melanogaster GN=Act57B PE=3 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 188/220 (85.45%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +S+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHET YNSIMKCDVDIRKDLY NIV+SGG+TM+PGIADRM KEIT+LAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_LUMTE (Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 189/220 (85.91%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +SSS+EK+YELPDGQ+ITIG ERFRCPE +F  S +GME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMNTASASSSLEKSYELPDGQVITIGNERFRCPEAMFHASFLGMESVGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_BOMMO (Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 188/220 (85.45%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +S+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHET YNSIMKCDVDIRKDLY N V+SGG+TM+PGIADRM KEITALAPS++KIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_AEDAE (Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2)

HSP 1 Score: 391.734 bits (1005), Expect = 2.880e-108
Identity = 189/220 (85.91%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +S+S+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHET YNSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPSS+KIK++APPERKYSVWIGGSILASLSTFQ MWISK EYDESGP+IVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSSIKIKIIAPPERKYSVWIGGSILASLSTFQAMWISKQEYDESGPAIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_TAESO (Actin OS=Taenia solium GN=ACT1 PE=3 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.761e-108
Identity = 189/220 (85.91%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H+VPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+AGIHE+T+N+IMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEIT+LAPS+MKIK+VAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVTHSVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHESTFNAIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_SACKO (Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.761e-108
Identity = 189/220 (85.91%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQP+ +GME+ GIHETTYNSIMKCD+DIRKDLY   VLSGG++M+PGIADRM KEIT+LAPSSMKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPAFLGMESPGIHETTYNSIMKCDIDIRKDLYAFSVLSGGTSMYPGIADRMQKEITSLAPSSMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_DIPDE (Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.761e-108
Identity = 189/220 (85.91%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H+VPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+AGIHE+T+N+IMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEIT+LAPS+MKIK+VAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVTHSVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHESTFNAIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT_MANSE2.880e-10885.45Actin, muscle OS=Manduca sexta PE=2 SV=1[more]
ACTSB_TAKRU2.880e-10885.91Actin, alpha skeletal muscle B OS=Takifugu rubripe... [more]
ACTM_CIOSA2.880e-10885.91Actin, muscle OS=Ciona savignyi PE=2 SV=1[more]
ACT3_DROME2.880e-10885.45Actin-57B OS=Drosophila melanogaster GN=Act57B PE=... [more]
ACT2_LUMTE2.880e-10885.91Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1[more]
ACT1_BOMMO2.880e-10885.45Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1[more]
ACT1_AEDAE2.880e-10885.91Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2[more]
ACT_TAESO3.761e-10885.91Actin OS=Taenia solium GN=ACT1 PE=3 SV=1[more]
ACT2_SACKO3.761e-10885.91Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1[more]
ACT2_DIPDE3.761e-10885.91Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top