EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT1_PNECA (Actin-1 OS=Pneumocystis carinii PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.094e-107
Identity = 188/220 (85.45%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRL+LAGRDLTD LMKILTERGY +TTTAEREIVRD+KE+L YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQPS++GME  GIHETT+NSIMKCDVDIRKDLY NIV+SGG+TM+PGIADRM KEITALAPSSMKIK+VAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GPSIV+RKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLNLAGRDLTDYLMKILTERGYNYTTTAEREIVRDIKERLCYVALDFEQEIHTASSSSSLEKSYELPDGQVITIGNERFRAPEALFQPSIVGMETCGIHETTFNSIMKCDVDIRKDLYSNIVMSGGTTMYPGIADRMQKEITALAPSSMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDENGPSIVYRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_CRYNV (Actin OS=Cryptococcus neoformans var. grubii PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.429e-107
Identity = 186/220 (84.55%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEG++LPHAILR+DLAGRDLTD L+KIL ERGY+FTT+AEREIVRD+KEKL YVALD EQEL+TA  SS +EK+YELPDGQ+ITIG ERFRCPE LFQPSL+G+EAAGIHETTYNSIMKCD+DIRKDLYGNIV+SGG+TM+ GIADRM KEITALAPSSMK+K+V+PPERKYSVWIGGSILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGFSLPHAILRIDLAGRDLTDYLVKILMERGYLFTTSAEREIVRDIKEKLCYVALDCEQELQTAAQSSQLEKSYELPDGQVITIGNERFRCPEALFQPSLLGLEAAGIHETTYNSIMKCDLDIRKDLYGNIVMSGGTTMYNGIADRMQKEITALAPSSMKVKIVSPPERKYSVWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTE_STRPU (Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.429e-107
Identity = 191/220 (86.82%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFR  E LFQPS IGME+AGIHET YN IMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEI+ALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRASETLFQPSFIGMESAGIHETCYNRIMKCDVDIRKDLYVNTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTM_STYPL (Actin, muscle OS=Styela plicata PE=3 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.867e-107
Identity = 187/220 (85.00%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSH VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME++G+HETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MK K++APPERKYSVWIG SILASLSTFQQMWI+K EYDESGPSIVHRKCF
Sbjct:  160 GDGVSHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESSGVHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKSKIIAPPERKYSVWIGASILASLSTFQQMWITKQEYDESGPSIVHRKCF 379          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_XENLA (Actin, alpha sarcomeric/cardiac OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.867e-107
Identity = 187/220 (85.00%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHET YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETAYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTS_CYPCA (Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.438e-107
Identity = 186/220 (84.55%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VP+YEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHET YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETAYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTS_CARAU (Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.438e-107
Identity = 186/220 (84.55%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+H VP+YEGYALPHAI+RLDLAGRDLTD LMKILTERGY F TTAEREIVRD+KEKL YVALD+E E+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS IGME+AGIHET YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWI+K EYDE+GPSIVHRKCF
Sbjct:  158 GDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETAYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_STRPU (Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.438e-107
Identity = 190/220 (86.36%), Postives = 204/220 (92.73%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA SSSS+EK+YELPDGQ+ITIG ERFR PE LFQP+ +GME+AGIHET YNSIMKCDVDIRKDLY N VLSGGSTM+P  ADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRAPEALFQPAFLGMESAGIHETCYNSIMKCDVDIRKDLYANSVLSGGSTMYPIAADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT6_TOBAC (Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 5.431e-107
Identity = 194/199 (97.49%), Postives = 198/199 (99.50%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQ 608
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYMFTTTAEREIVRDMKE+LAYVALDYEQEL+TAKSSSSVEKNYELPDGQ+ITIGAERFRCPEVLFQPS+IGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQ
Sbjct:  138 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYMFTTTAEREIVRDMKEELAYVALDYEQELDTAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQ 336          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_FUCVE (Actin OS=Fucus vesiculosus PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 7.093e-107
Identity = 186/220 (84.55%), Postives = 205/220 (93.18%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAI RLDLAGRDLTD LMK+LTERGY FTTTAEREIVRD+KEKL YVALD++QE++TA  SS +EK+YELPDG +I IG ERFRCPEVLFQPS IGME++GIH+ T+ +IMKCDVDIRKDLYGNIVLSGG+TMFPGI +RM+KE+TALAPS+MKIKVVAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAINRLDLAGRDLTDNLMKVLTERGYSFTTTAEREIVRDIKEKLTYVALDFDQEMKTAAESSQLEKSYELPDGNVIVIGNERFRCPEVLFQPSFIGMESSGIHDCTFKTIMKCDVDIRKDLYGNIVLSGGTTMFPGIGERMTKELTALAPSTMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPSIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT1_PNECA1.094e-10785.45Actin-1 OS=Pneumocystis carinii PE=2 SV=1[more]
ACT_CRYNV1.429e-10784.55Actin OS=Cryptococcus neoformans var. grubii PE=3 ... [more]
ACTE_STRPU1.429e-10786.82Actin, cytoskeletal 3A OS=Strongylocentrotus purpu... [more]
ACTM_STYPL1.867e-10785.00Actin, muscle OS=Styela plicata PE=3 SV=1[more]
ACT2_XENLA1.867e-10785.00Actin, alpha sarcomeric/cardiac OS=Xenopus laevis ... [more]
ACTS_CYPCA2.438e-10784.55Actin, alpha skeletal muscle OS=Cyprinus carpio GN... [more]
ACTS_CARAU2.438e-10784.55Actin, alpha skeletal muscle OS=Carassius auratus ... [more]
ACTC_STRPU2.438e-10786.36Actin, cytoskeletal 2A OS=Strongylocentrotus purpu... [more]
ACT6_TOBAC5.431e-10797.49Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=... [more]
ACT_FUCVE7.093e-10784.55Actin OS=Fucus vesiculosus PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top