EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACL6A_HUMAN (Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.489e-35
Identity = 92/256 (35.94%), Postives = 134/256 (52.34%), Query Frame = 3
Query:   18 GVSHT--VPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTT---AEREIVRD-------MKEKLAYVAL------------DYEQELETAKSSSSVEK--------NYELPDGQIITIGAERFRCPEVLFQPS----LIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVA---PPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            G +HT  +P+++GY L   I++  LAG  +T    ++  E           A +E VR+        KEKL  V              D++  +     S+  E+        +YE P+G     GAER + PE LF PS    L G    G+      S+  CD+DIR  LYG+++++GG+T+     DR+++E++   P SM++K++A     ER++S WIGGSILASL TFQQMWISK EY+E G   V RKC
Sbjct:  173 GATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_CAEBR (Actin-related protein 3 OS=Caenorhabditis briggsae GN=arx-1 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.739e-32
Identity = 82/239 (34.31%), Postives = 123/239 (51.46%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALA----------------PSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ +GY +   I  + +AGRD+T  +  +L ER +        E+ + +KEK  YV  D  +E     + SS  K     DG          + +G ERF  PE+ F P     +    I +T    I +C +D+R+ LY NIVLSGGSTMF   A ++ +++  L+                P  + ++V++   ++Y+VW GGS+LAS S F Q+  SK EY E GPSI
Sbjct:  179 GDGVTHCIPVADGYVIGSCIKHIPIAGRDITYFIQNLLREREHTIPAEQSYEVAKTIKEKFCYVCPDVMKEFVKYDTDSS--KWLRTYDGINSITKRPFSVDVGYERFLGPEIFFHPEFCNPDFTTPISDTIDTLIQQCPIDVRRGLYENIVLSGGSTMFKDFARKLQRDVKRLSDARLQMSETLSGGRLKPKPIDVQVISHKMQRYAVWFGGSMLASTSEFYQVSHSKAEYMEKGPSI 415          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: CT134_HUMAN (Putative uncharacterized actin family protein C20orf134 OS=Homo sapiens GN=C20orf134 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.848e-31
Identity = 73/221 (33.03%), Postives = 123/221 (55.66%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGY-MFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAP----SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVH 659
            G GV H  PIY G++   A  RL++AG  L+  L  +L      +      R+ +  +K++  YV+LD+E +L           ++ + +G  + + +ERFRCPE +FQP L+G    G+    + ++ K    +R  L   +VL+GGST+FPG A+R+ KE+ A       ++++  +VA   R  +VW GGS++ASL +FQ+ WI++  Y E G  +++
Sbjct:   23 GAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLLVAANPDLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPARHHPA--SFSVGNGCCVCLSSERFRCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVVLAGGSTLFPGFAERLDKELEAQCRRHGYAALRPHLVAKHGRGMAVWTGGSMVASLHSFQRRWITRAMYQECGSRLLY 241          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_CAEEL (Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.720e-31
Identity = 80/239 (33.47%), Postives = 122/239 (51.05%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALA----------------PSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ +GY +   I  + +AGRD+T  +  +L +R +        E+ + +KEK  YV  D  +E    K  +   K     DG          + +G ERF  PE+ F P     E    I +T    I +C +D+R+ LY NIVLSGGSTMF   A ++ +++  L+                P  + ++V++   ++Y+VW GGS+LAS S F Q+  +K EY E GPSI
Sbjct:  178 GDGVTHCIPVADGYVIGSCIKHIPIAGRDITYFIQSLLRDREHTIPAEQSYEVAKMIKEKFCYVCPDVMKEF--VKYDTDAAKWLRTYDGINSITKKPFNVDVGYERFLGPEIFFHPEFCNPEFTTPISDTIDTLIQQCPIDVRRGLYENIVLSGGSTMFKDFARKLQRDVKRLSDGRLQMSETLSGGRLKPKPIDVQVISHKMQRYAVWFGGSMLASTSEFYQVSHTKAEYMERGPSI 414          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: CT134_MOUSE (Putative uncharacterized actin family protein C20orf134 homolog OS=Mus musculus PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.345e-31
Identity = 80/227 (35.24%), Postives = 128/227 (56.39%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAG-------RDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQEL-ETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAP----SSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIV 656
            G GV H  PIY G++   A  RL++AG       RDL  A    L  +G        R+ V  +K++  YV+LD++ ++ + A+   +    + L +G  + +G+ERFRCPE +FQPSL+G    G+    + ++ K    +R  L   +VL+GGST+FPG  +RM+ E+ A        +++  +VA P R  +VW GGS++ASL++FQ  W+++  Y E GP +V
Sbjct:  124 GAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVAACPDLQLQGL------SRKTVTQLKKRCCYVSLDFQGDICDPARHQRAC---FCLGNGCYVRLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELEAQCRRHGYPALQPCLVAHPGRDTAVWTGGSMMASLNSFQCRWMTRAMYQEHGPLLV 341          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_ARATH (Actin-related protein 6 OS=Arabidopsis thaliana GN=ARP6 PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.846e-30
Identity = 83/263 (31.56%), Postives = 128/263 (48.67%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKN-YELPDGQIITIGA------------------------------------------ERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G   +H VP+   + L HAI R+DL G+  T+ L ++++ R        E  +V D KEKL +V+LD  ++L  A++ +++ K+ Y LPDG   T G                                           ERF  PE LFQP+ +GM  AG+ E    +I  C   ++  LY +I+L+GGST+FP + +R+  E+  L P    +K+    +    VW GGS+LAS   F+ M ++K EY+E G +   R+ F
Sbjct:  160 GFSFTHAVPVLHNFTLNHAIKRIDLGGKAFTNYLKELVSYRS--INVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTLIKSTYVLPDGVTHTKGYVKDPQAAKRFLSLSEKESVVVMDKVGERKKADMNKNEIDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFF 420          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_YEAST (Actin-related protein 3 OS=Saccharomyces cerevisiae GN=ARP3 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 5.372e-30
Identity = 77/237 (32.49%), Postives = 127/237 (53.59%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTT--TAEREIVRDMKEKLAYVALDYEQEL-----ETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALA--------------PSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIV 656
            GDGV+H +P+ EGY +  AI  + +AGRD+T  +  +L ERG   T+  TAE+     +K++  YV  D  +E      + +K +  V +N E    +++ IG ERF  PE+ F P +   +    +      +I  C +D+RK LY NIVLSGGSTMF     R+ +++ ++                + + + V++  +++ +VW GGS+LA  + F+    +K +Y+E GP IV
Sbjct:  209 GDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIV 440          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_ACACA (Actin-related protein 3 OS=Acanthamoeba castellanii GN=ARP3 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.015e-30
Identity = 75/239 (31.38%), Postives = 126/239 (52.72%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +  +I  + LAGRD+T+ ++++L ER          E+ + +KE  +YV  D  +E +  K  +  +K ++  +G          + +G ERF  PE+ F P +   +    + +    +I  C +D R+ LY NIVLSGGSTMF     R+ ++I                  +   ++ +KV++   ++++VW GGS+LAS   F ++  +K +YDE GPSI
Sbjct:  179 GDGVTHVIPVAEGYVIGSSIKHIPLAGRDITNFVLQLLRERNEKIPPAETLEVAKRIKETFSYVCPDIVKEFK--KYDTEPDKWFKTYEGIESVGKKPYNVDVGYERFLGPEIFFNPEIFSSDFLTPLPKVVDETIQSCPIDTRRGLYKNIVLSGGSTMFKDFGKRLQRDIKRAVDYRIKRSEELSQGRIKSKAVDVKVISHHMQRFAVWFGGSMLASTPEFYKVCHTKQQYDEVGPSI 415          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP7_ARATH (Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.547e-29
Identity = 81/226 (35.84%), Postives = 115/226 (50.88%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPE------RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G G     P+ EG     A  R +L G +LT    + L +       +     V  +KE+ A  A   E E+   K+ +   + + LPDGQ+I+IG ER+   E LFQPS++G+E  GI E     I     +  + L  N VL GG+T   G   R  KE   L  S+++  +V PPE        YS W+GG+ILA +   Q   ++K +YDE+GPS+VHRKCF
Sbjct:  144 GHGKIDIAPVLEGAVQHIASKRFELGGTELTKLFAQELGKTNPSMNLSMSD--VEKLKEQYANCA---EDEIAYKKTQNCEIEQHTLPDGQVISIGRERYSVGEALFQPSILGLEEHGIVEQLVRIISTVSSENHRQLLENTVLCGGTTSMTGFESRFQKEAN-LCSSAIRPTLVKPPEYMPENLGMYSAWVGGAILAKVVFPQNQHVTKADYDETGPSVVHRKCF 363          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_DROME (Actin-related protein 3 OS=Drosophila melanogaster GN=Arp66B PE=1 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 1.013e-28
Identity = 76/239 (31.80%), Postives = 117/239 (48.95%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQEL--------ETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGR++T  +  +L ER          E  + +KEK  Y+  D  +E         +  ++ S V    + P    + +G ERF  PE+ F P     +    + E   N I  C +D+R+ LY NIVLSGGSTMF     R+ ++I                  + P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K  Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFN--VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSI 407          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACL6A_HUMAN2.489e-3535.94Actin-like protein 6A OS=Homo sapiens GN=ACTL6A PE... [more]
ARP3_CAEBR5.739e-3234.31Actin-related protein 3 OS=Caenorhabditis briggsae... [more]
CT134_HUMAN2.848e-3133.03Putative uncharacterized actin family protein C20o... [more]
ARP3_CAEEL3.720e-3133.47Actin-related protein 3 OS=Caenorhabditis elegans ... [more]
CT134_MOUSE6.345e-3135.24Putative uncharacterized actin family protein C20o... [more]
ARP6_ARATH1.846e-3031.56Actin-related protein 6 OS=Arabidopsis thaliana GN... [more]
ARP3_YEAST5.372e-3032.49Actin-related protein 3 OS=Saccharomyces cerevisia... [more]
ARP3_ACACA7.015e-3031.38Actin-related protein 3 OS=Acanthamoeba castellani... [more]
ARP7_ARATH4.547e-2935.84Actin-related protein 7 OS=Arabidopsis thaliana GN... [more]
ARP3_DROME1.013e-2831.80Actin-related protein 3 OS=Drosophila melanogaster... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top