EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP7_ORYSJ (Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 2.257e-28
Identity = 81/226 (35.84%), Postives = 116/226 (51.33%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPE------RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G G     P+ EG     A  R D+ G DLT+   + L +     +   +   V  +KE+ A  A D  Q    A  SS   + + LPDGQ+ITI  ER+   E LFQP ++G+E  GI      S+     +  + L  N +L GG+    G  DR  +E   L+ S++   +V PPE       +YS W+GG+ILA +   Q   ++KG+YDE+GPSIVH+KCF
Sbjct:  140 GHGKIDIAPVCEGAVQHIASKRFDIGGTDLTNLFAEELKKSNS--SVNIDISDVERLKEQYACCAED--QMAFEAIGSSCRPERHTLPDGQVITIEKERYIVGEALFQPHILGLEDYGIVHQLVTSVSNVTPEYHRQLLENTMLCGGTASMTGFEDRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 360          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP7_ORYSI (Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 2.257e-28
Identity = 81/226 (35.84%), Postives = 116/226 (51.33%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPE------RKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G G     P+ EG     A  R D+ G DLT+   + L +     +   +   V  +KE+ A  A D  Q    A  SS   + + LPDGQ+ITI  ER+   E LFQP ++G+E  GI      S+     +  + L  N +L GG+    G  DR  +E   L+ S++   +V PPE       +YS W+GG+ILA +   Q   ++KG+YDE+GPSIVH+KCF
Sbjct:  140 GHGKIDIAPVCEGAVQHIASKRFDIGGTDLTNLFAEELKKSNS--SVNIDISDVERLKEQYACCAED--QMAFEAIGSSCRPERHTLPDGQVITIEKERYIVGEALFQPHILGLEDYGIVHQLVTSVSNVTPEYHRQLLENTMLCGGTASMTGFEDRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQNQHVTKGDYDETGPSIVHKKCF 360          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_TAKRU (Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.257e-28
Identity = 80/237 (33.76%), Postives = 116/237 (48.95%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSS------VEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADR--------------MSKEITA--LAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T    ++L ER          E  + +KE+ +YV  D  +E     +  S         N        I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R              MS+E++   L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFNKYDTDGSKWIKQYTGINAITKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKMSEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3B_MOUSE (Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.257e-28
Identity = 78/239 (32.64%), Postives = 118/239 (49.37%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L ER          E  + +KEK  Y+  D  +E   AK      K  +   G         II +G ERF  PE+ F P     +    I +     I  C +D+R+ LY N+VLSGGSTMF     R+ +++                  + P  ++++VV    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVREF--AKYDVDPRKWIKQYTGINAINQKKFIIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQSCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3B_HUMAN (Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.947e-28
Identity = 77/239 (32.22%), Postives = 118/239 (49.37%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDG--------QIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L ER          E  + +KEK  Y+  D  +E   AK      K  +   G         +I +G ERF  PE+ F P     +    I +     I  C +D+R+ LY N+VLSGGSTMF     R+ +++                  + P  ++++VV    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEF--AKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_CHICK (Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.849e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSS------VEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L ER          E  + +KE+ +YV  D  +E     +  +         N        I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFNKYDTDGTKWIKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_RAT (Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSS------VEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L +R          E  + +KE+ +YV  D  +E     +  S         N        I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_PONAB (Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQI------ITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L +R          E  + +KE+ +YV  D  +E     +  S           I      I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_MOUSE (Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSS------VEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L +R          E  + +KE+ +YV  D  +E     +  S         N        I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_HUMAN (Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQI------ITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L +R          E  + +KE+ +YV  D  +E     +  S           I      I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ARP7_ORYSJ2.257e-2835.84Actin-related protein 7 OS=Oryza sativa subsp. jap... [more]
ARP7_ORYSI2.257e-2835.84Actin-related protein 7 OS=Oryza sativa subsp. ind... [more]
ARP3_TAKRU2.257e-2833.76Actin-related protein 3 OS=Takifugu rubripes GN=ac... [more]
ARP3B_MOUSE2.257e-2832.64Actin-related protein 3B OS=Mus musculus GN=Actr3b... [more]
ARP3B_HUMAN2.947e-2832.22Actin-related protein 3B OS=Homo sapiens GN=ACTR3B... [more]
ARP3_CHICK3.849e-2832.07Actin-related protein 3 OS=Gallus gallus GN=ACTR3 ... [more]
ARP3_RAT5.028e-2832.07Actin-related protein 3 OS=Rattus norvegicus GN=Ac... [more]
ARP3_PONAB5.028e-2832.07Actin-related protein 3 OS=Pongo abelii GN=ACTR3 P... [more]
ARP3_MOUSE5.028e-2832.07Actin-related protein 3 OS=Mus musculus GN=Actr3 P... [more]
ARP3_HUMAN5.028e-2832.07Actin-related protein 3 OS=Homo sapiens GN=ACTR3 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top