EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_DICDI (Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 77/242 (31.82%), Postives = 121/242 (50.00%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQE-----------LETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK----------------IKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +PI EGY +  +I  + +AGRD++  + +I+ ER          EI + +KE+ +YV  D  +E           ++T  +  SV K     D     +G ERF  PE+ F P +   +    + +   ++I  C +D R+ LY NIVLSGGSTMF     R+ +++       +K                + V++   ++Y+VW GGS+LAS   F  +  +K +YDE GPSI
Sbjct:  171 GDGVTHVIPISEGYVIGSSIKHIPIAGRDISSYVQQIMREREPNIPPAESLEIAKRVKEQYSYVCPDIVKEFGKYDSEPDKWIKTINAQDSVTKKPFSYD-----VGYERFLGPELFFNPEIASSDYLTPLPKVVDDTIQSCPIDCRRGLYKNIVLSGGSTMFKDFGKRLQRDVKRSVDYRIKRSEELSGGKIKAVPLAVNVISHNMQRYAVWFGGSMLASTPEFYNVCHTKAQYDEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_BOVIN (Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3)

HSP 1 Score: 125.176 bits (313), Expect = 5.028e-28
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQI------ITIGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEIT----------------ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSI 653
            GDGV+H +P+ EGY +   I  + +AGRD+T  + ++L +R          E  + +KE+ +YV  D  +E     +  S           I      I +G ERF  PE+ F P     +    I E     I  C +D+R+ LY NIVLSGGSTMF     R+ +++                  L P  + ++V+    ++Y+VW GGS+LAS   F Q+  +K +Y+E GPSI
Sbjct:  171 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSI 407          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP42_SCHPO (SWI/SNF and RSC complexes subunit arp42 OS=Schizosaccharomyces pombe GN=arp42 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.559e-27
Identity = 70/185 (37.84%), Postives = 101/185 (54.59%), Query Frame = 3
Query:  159 EREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAA---------GIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKV---VAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPS---IVHRKC 668
            +R ++ + KE +  V    +   + AK+SS   K +E PDG     G ERFR  E+LF PS     +A         G+HE  Y SI+ CD ++R  L  NIV++GG+++ PG+++R+  E+  LA  S +I V           +VW GGSILASL  FQ +W+SK EYDE G      V ++C
Sbjct:  249 KRRVIEEWKESVLDVL---DTPFDEAKASSRNPKPFEFPDGVTHKFGQERFRISEILFNPSFSASRSAETTPPQGSVGLHELVYQSILACDSELRSPLLNNIVVTGGTSLIPGLSERLQAEVQRLATGS-RINVHTAETASATSNAVWFGGSILASLDNFQHLWVSKQEYDEVGVDRALFVEKRC 429          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_HUMAN (Actin-related protein 6 OS=Homo sapiens GN=ACTR6 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.482e-27
Identity = 71/245 (28.98%), Postives = 122/245 (49.80%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAK---SSSSVEKNYELPD------------------------GQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRK 665
            G   +H VP         AI+R+++ G+ LT+ L +I++ R        E  ++  +KE + YV+ D+ ++++ AK     ++V  +Y LPD                         QI+ +  ERF  PE+LF PS IG++  GI E    SI     +++   + NIVL+GG+++FPG  DR+  E+  L P+   + VV P       W GG +++    F+ M +++ +Y+E+G S+   K
Sbjct:  151 GYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_CHICK (Actin-related protein 6 OS=Gallus gallus GN=ACTR6 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.482e-27
Identity = 72/245 (29.39%), Postives = 122/245 (49.80%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAK---SSSSVEKNYELPD------------------------GQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRK 665
            G   +H VP         AI+R+++ G+ LT+ L +I++ R        E  ++  +KE + YV+ D+ +++E AK     ++V  +Y LPD                         QI+ +  ERF  PE+LF PS IG++  GI E   +SI     +++   + NIVL+GG+T+FPG  DR+  E+  L P+   + VV P       W GG +++    F+ + +++ +Y+E G +I   K
Sbjct:  151 GYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYKDMEIAKLKGEENTVMVDYVLPDFSTIKKGFCKPREEMVLSGKYKTGEQILRLTNERFAVPEILFHPSDIGIQEMGIPEAIVDSIQNLPEEMQPHFFKNIVLTGGNTLFPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYSWEGGKLISENDDFEDLVVTREDYEEHGHNICEEK 393          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_USTMA (Actin-related protein 4 OS=Ustilago maydis GN=ARP4 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.482e-27
Identity = 80/211 (37.91%), Postives = 107/211 (50.71%), Query Frame = 3
Query:  168 IVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLI-----------------------------------------GMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            +V D KE +A V L+   + + A+  S   + YE PDG     G ER R  EVLF P+L                                          G  A G+ +   +SI   DVD R  LYGNIVL GGS++  G++DR+S E+   AP+  KIK+ +P    ER++S W+G SILASL TF Q+WISK EY+E G +IVH +C
Sbjct:  327 VVNDFKESVAQV-LEVPWDDQQAQFRSG--RMYEFPDGYNDAFGVERLRAAEVLFTPALWNGVSSSESFGAVLHASSQPSSEAGAVNGGSVSAAGATSVAGGKAAIGLADMVLSSINAVDVDSRPSLYGNIVLVGGSSLIQGLSDRLSYELGVKAPNQ-KIKIHSPGNTTERRHSSWLGASILASLGTFHQLWISKQEYEEHGAAIVHARC 533          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_ORYSJ (Actin-related protein 6 OS=Oryza sativa subsp. japonica GN=ARP6 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.617e-26
Identity = 78/272 (28.68%), Postives = 125/272 (45.96%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEK---NYELPD------------------------GQII-------------------------TIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G   +H  P+ + + L +A+ R+DL G+ LT+ L ++++ R        E  ++ D KEKL +V+LD   +L  A+ SS+      +Y LPD                        G+ +                          +  ERF  PE+LF P  +GM  AG+ E    +I  C   ++  L+  I+L+GGST+FP   +R+ KE+  L P   ++K++A  +     W GGS+LA    F+ M I+K EY+E G     R+ F
Sbjct:  159 GFSFTHASPVLQNFTLNYAVRRMDLGGKALTNYLKELISYRS--LNVMDETLLIDDAKEKLCFVSLDVPGDLRLARLSSNDNPFRCSYILPDGITYKKGFVKDLDEACRYSSLPANGESVRKDSSDSDRSKFEDKKKPELSQNEFVLTNERFLVPEMLFHPIDLGMNQAGLAECIVRAIQACHPHLQPVLFERIILTGGSTLFPRFTERLEKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_ORYSI (Actin-related protein 6 OS=Oryza sativa subsp. indica GN=ARP6 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.617e-26
Identity = 78/272 (28.68%), Postives = 125/272 (45.96%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEK---NYELPD------------------------GQII-------------------------TIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            G   +H  P+ + + L +A+ R+DL G+ LT+ L ++++ R        E  ++ D KEKL +V+LD   +L  A+ SS+      +Y LPD                        G+ +                          +  ERF  PE+LF P  +GM  AG+ E    +I  C   ++  L+  I+L+GGST+FP   +R+ KE+  L P   ++K++A  +     W GGS+LA    F+ M I+K EY+E G     R+ F
Sbjct:  159 GFSFTHASPVLQNFTLNYAVRRMDLGGKALTNYLKELISYRS--LNVMDETLLIDDAKEKLCFVSLDVPGDLRLARLSSNDNPFRCSYILPDGITYKKGFVKDLDEACRYSSLPANGESVRKDSSDSDRSKFEDKKKPELSQNEFVLTNERFLVPEMLFHPIDLGMNQAGLAECIVRAIQACHPHLQPVLFERIILTGGSTLFPRFTERLEKELRPLVPDDYQVKIIAQEDPILGAWRGGSLLAHRPDFESMCITKSEYEEMGSMRCRRRFF 428          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP3_NEUCR (Actin-related protein 3 OS=Neurospora crassa GN=arp-3 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 3.603e-26
Identity = 71/237 (29.96%), Postives = 117/237 (49.37%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSS--VEKNYELPDGQIIT--IGAERFRCPEVLFQPSLIGME-AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK---------------IKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHR 662
            GDGV+H +P+ EGY +  +I  + +AGRD+T  +  +L +RG      +  +  +++KE+  YV  D  +E        S  ++     P G+ +T  +G ERF  PE+ F P +   +    +       I    +D+R+ LY NIVLSGGST++     R+ ++I  L  + +K               ++V+    +++  W GGS+L     F+    +K EY E GPSIV R
Sbjct:  196 GDGVTHVIPVAEGYVIGSSIKSIPIAGRDITYFVQSLLRDRG---EPDSSLKTAQEIKEEYCYVCPDIVKEFAKYDRDRSRFLKHTITQPGGRQVTVDVGYERFMAPEIFFNPEIYSSDFLTPLPVVVDGVIQSSPIDVRRGLYKNIVLSGGSTLYKDFGRRLQRDIKQLVDTRIKASEVRSGGAKSGGLDVQVITHKRQRHGPWFGGSLLGQTPEFRSYCHTKAEYQEYGPSIVRR 429          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_MOUSE (Actin-related protein 6 OS=Mus musculus GN=Actr6 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 4.706e-26
Identity = 70/245 (28.57%), Postives = 122/245 (49.80%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAK---SSSSVEKNYELPD------------------------GQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRK 665
            G   +H VP         AI+R+++ G+ LT+ L +I++ R        E  ++  +KE + YV+ D+ ++++ AK     ++V  +Y LPD                         QI+ +  ERF  PE+LF PS IG++  GI E    SI     +++   + NIVL+GG+++FPG  +R+  E+  L P+   + VV P       W GG +++    F+ M +++ +Y+E+G S+   K
Sbjct:  151 GYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEDNTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRERVYSEVRCLTPTDYDVSVVLPENPITYSWEGGKLISENDDFEDMVVTREDYEENGHSVCEEK 393          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ARP3_DICDI5.028e-2831.82Actin-related protein 3 OS=Dictyostelium discoideu... [more]
ARP3_BOVIN5.028e-2832.07Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=... [more]
ARP42_SCHPO5.559e-2737.84SWI/SNF and RSC complexes subunit arp42 OS=Schizos... [more]
ARP6_HUMAN9.482e-2728.98Actin-related protein 6 OS=Homo sapiens GN=ACTR6 P... [more]
ARP6_CHICK9.482e-2729.39Actin-related protein 6 OS=Gallus gallus GN=ACTR6 ... [more]
ARP4_USTMA9.482e-2737.91Actin-related protein 4 OS=Ustilago maydis GN=ARP4... [more]
ARP6_ORYSJ1.617e-2628.68Actin-related protein 6 OS=Oryza sativa subsp. jap... [more]
ARP6_ORYSI1.617e-2628.68Actin-related protein 6 OS=Oryza sativa subsp. ind... [more]
ARP3_NEUCR3.603e-2629.96Actin-related protein 3 OS=Neurospora crassa GN=ar... [more]
ARP6_MOUSE4.706e-2628.57Actin-related protein 6 OS=Mus musculus GN=Actr6 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top