EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTL8_HUMAN (Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.855e-23
Identity = 64/215 (29.77%), Postives = 107/215 (49.77%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYV------ALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDE 638
            G G++   P ++G  LP +   L+ AG+DL+  L+K L +         + E V   +    YV      ALD+ +  ++A   S+    Y+LPDG  + +   +   PE+ F P +       I      S+  C++ +R  L  +++  GG+T++PG   R+ +E+     SS K  V     R +SVW+G S++A LST+Q  W+S+ EY E
Sbjct:  151 GYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNT---YQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGE 362          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_EMENI (Actin-related protein 4 OS=Emericella nidulans GN=arp4 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.085e-22
Identity = 60/154 (38.96%), Postives = 89/154 (57.79%), Query Frame = 3
Query:  246 SSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGME----------AAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            S+  + +E PDG     G +R+R  E LF      ++          A  I E    ++   DVD+R  L  N+V++G S++  G  DR+++E+  L P   ++++ AP    ER++S WIGGSILASL TF QMWISK E+DE GP+IV ++C
Sbjct:  319 STPGRPFEFPDGYNQVFGVDRYRVVESLFDAKATILDPDSQFPAPTPAQTIPELIKAALNGVDVDLRPHLLANVVVTGASSLLYGFTDRLNQELMQLYPGP-RVRISAPGNTSERRFSSWIGGSILASLGTFHQMWISKKEFDEHGPNIVEKRC 471          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_EMENI (Actin-like protein arp6 OS=Emericella nidulans GN=arp6 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.417e-22
Identity = 74/263 (28.14%), Postives = 122/263 (46.39%), Query Frame = 3
Query:   18 GVSHTV--PIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETA----------KSSSSVEKNYELPDGQ----------------------------------IITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA-SLSTFQQMWISKGEYDESGPSIVHRK 665
            G SHTV  P+Y G  L   I RLDL G+ LT+ L ++++ R Y      E  I+ ++KE + +V+ D+ ++LE              +  V  +Y LPD                                    ++ +G ERF  PE+LF PS IGM++AGI +    S+      +      N+++ GG+++ PG  +R+  E+  +A +   ++V  P +     W+GGS LA +    +++ I++ EY E G S   RK
Sbjct:  214 GYSHTVITPVYRGRPLQRGIRRLDLGGKHLTNYLKELVSMRQYNMVD--ETYIMNEVKESVCFVSNDFNRDLERTWKGNRKRGQPDPTDGVVVDYVLPDPNGGKRGFMRPHDPLLGSKKRKAVLAGASAEQLNEDVLVLGNERFTVPEILFTPSDIGMKSAGIPDIILQSLSVLPTGLHPAFLANVLVVGGNSLLPGFMERLETELRQIASAECVVRVRRPKDPIRFAWLGGSRLATNKEELKKVAITRQEYQEHGSSWTTRK 474          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP8_ORYSJ (Actin-related protein 8 OS=Oryza sativa subsp. japonica GN=ARP8 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.417e-22
Identity = 71/227 (31.28%), Postives = 118/227 (51.98%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKC---DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPS--SMKIKVVAPPERKYSVWIGGSILASLSTFQQMW-ISKGEYDE----SGPSIVH 659
            G   +  VPI++G  +    +  +      LT  L +++ +R   F +      VR +KEKL YVA DYE     A+     + + E+      T+  ERF+  E+LFQP + G+ A G+H+     +  C   +V    + Y  +VLSGGS+  PG+++R+ KE+  L P+  S  I+V+ PP    S W G  +++++STF + W I K ++ +    +GPS V+
Sbjct:  264 GFNATSIVPIFQGRVMHEIGVETVGQGALKLTGFLKELMQQRNITFESLYT---VRTIKEKLCYVAADYE-----AEKRKDTQASCEVDGEGWFTLSEERFKTAEILFQPQIGGVRAMGLHKAVSLCMDHCYNSEVFGDDNWYKTVVLSGGSSCLPGLSERLEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP8_ORYSI (Actin-related protein 8 OS=Oryza sativa subsp. indica GN=ARP8 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.417e-22
Identity = 71/227 (31.28%), Postives = 118/227 (51.98%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKC---DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPS--SMKIKVVAPPERKYSVWIGGSILASLSTFQQMW-ISKGEYDE----SGPSIVH 659
            G   +  VPI++G  +    +  +      LT  L +++ +R   F +      VR +KEKL YVA DYE     A+     + + E+      T+  ERF+  E+LFQP + G+ A G+H+     +  C   +V    + Y  +VLSGGS+  PG+++R+ KE+  L P+  S  I+V+ PP    S W G  +++++STF + W I K ++ +    +GPS V+
Sbjct:  264 GFNATSIVPIFQGRVMHEIGVETVGQGALKLTGFLKELMQQRNITFESLYT---VRTIKEKLCYVAADYE-----AEKRKDTQASCEVDGEGWFTLSEERFKTAEILFQPQIGGVRAMGLHKAVSLCMDHCYNSEVFGDDNWYKTVVLSGGSSCLPGLSERLEKELRELLPAHISEGIRVIPPPFGTDSAWFGAKMISNVSTFTEAWCIKKKQFRQKTRRNGPSFVN 482          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_ASPFU (Actin-related protein 4 OS=Aspergillus fumigatus GN=arp4 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.384e-22
Identity = 63/160 (39.38%), Postives = 89/160 (55.62%), Query Frame = 3
Query:  228 ETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQ-----PSLIGMEAAGIHETTYNSIMKC-----DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            E AKSS    + +E PDG     G +R+R  E LF      P    +  A     T   ++K      DVD+R  L  N+V++G S++  G  DR+++E+    P   ++++ A     ERK+  W+GGSILASL TF QMWISK EYDE GP+IV ++C
Sbjct:  309 EVAKSSPG--RPFEFPDGYNQVFGIDRYRVVESLFDAKAAIPDPESVFPAPTQAQTVPELIKAALNGVDVDVRPHLLANVVVTGASSLLYGFTDRLNQELMQSYPGP-RVRISASGNTAERKFGSWVGGSILASLGTFHQMWISKKEYDEHGPNIVEKRC 465          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_SCHPO (Actin-related protein 4 OS=Schizosaccharomyces pombe GN=arp4 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.032e-22
Identity = 68/231 (29.44%), Postives = 112/231 (48.48%), Query Frame = 3
Query:   81 DLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQP-----------------------------SLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGP---SIVHRKC 668
            +L  RD TD+  +   +R Y            + KE+ A ++     ++  +  ++  E  +E PDG  +  GAER++ PE LF P                             +       GI +   N I +CDVDIR  L  N+++ GG+++  G + R+  E++ L P S ++K+ A     ER Y+ W+GGSIL+SL TF Q+WIS+ EY+E G    +++ ++C
Sbjct:  219 ELRPRDTTDSYHQFQVQRVY-----------DEWKEECALIS-----DVPFSSETTIAESEFEFPDGSRMMFGAERYQIPEHLFVPGSDEEMNEEPSKPIEQTENNEVSQQDSSVTNTSSRILGIPQLFQNCISECDVDIRASLLNNVIVCGGTSLMQGFSLRLQNELSKLYPGS-RLKIHASGHVVERSYASWLGGSILSSLGTFHQLWISRQEYEEHGSDRLALIEKRC 432          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_ASPFU (Actin-like protein arp6 OS=Aspergillus fumigatus GN=arp6 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.567e-21
Identity = 70/263 (26.62%), Postives = 122/263 (46.39%), Query Frame = 3
Query:   18 GVSHTV--PIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETA----------KSSSSVEKNYELPDGQ----------------------------------IITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGS-ILASLSTFQQMWISKGEYDESGPSIVHRK 665
            G SHT   P+Y+G  +  AI RLD+ G+ LT+ L ++++ R Y      E  I+ ++KE + +V+ ++  +LE             ++  +  +Y LPD                                    ++ +G ERF  PE+LF PS IGM+ AGI +    S+      +      N+++ GG+T+ PG  +R+  E+  +A +   ++V  P +   S W+G S + A+ +  ++  I++ EY E G S   RK
Sbjct:  203 GYSHTTVTPVYKGQPIQRAIRRLDIGGKHLTNYLKEMVSMRQYNMVD--ETYIMNEVKEAVCFVSNNFAGDLEQTWQGNRKRGLTDAAEGITVDYVLPDPNTGKKGFMRPHDPLSNAKKRKSILSGGNAEALSEDVLILGNERFTVPEILFTPSDIGMKQAGIPDIILQSLSVLPTGLHPSFLANVLVVGGNTLIPGFLERLESELRQIASAECVVRVRRPHDPIRSTWLGASRLAANRAELRKFAITRQEYQEYGSSWAGRK 463          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_GIBZE (Actin-related protein 4 OS=Gibberella zeae GN=ARP4 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.123e-19
Identity = 57/147 (38.78%), Postives = 92/147 (62.59%), Query Frame = 3
Query:  264 YELPDGQIITIGAERFRCPEVLFQPSLIGM---EAAGIHET-TYNSIMKC-----DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            +E+PDG       +RFR  E ++  +  G    EA  +++T T   +++      DVD+R +L  N+V++G +++  G  DR++ E+ A+ P  +KIK+ A     ER++  WIGGSILASL TF QMWIS+ EY+E+GP++V ++C
Sbjct:  326 FEMPDGYNQMWREQRFRVTEGMWDENA-GYPIPEADRLNKTQTIPELIRAALNAVDVDLRGNLLANVVVTGSTSLINGFNDRLNTELMAMYPG-LKIKIHAAGLTSERRFGAWIGGSILASLGTFHQMWISRKEYEENGPNVVEKRC 470          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_NEUCR (Actin-related protein 4 OS=Neurospora crassa GN=arp-4 PE=3 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 2.501e-19
Identity = 62/191 (32.46%), Postives = 99/191 (51.83%), Query Frame = 3
Query:  144 FTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKN----YELPDGQIITIGAERFRCPEVLFQPSLI----GMEAAGIHETTYNSIMKC-----DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAP---PERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 668
            F    E  ++ + KE +  V     Q   T  +  +V       +E+PDG       +RF+  E ++  +        E       T  +++K      DVD+R ++ GN+V++G +++  G  DR++ E+  + P  +KIK+ A     ER++  WIGGSILASL TF QMWIS+ EYDE+G  IV ++C
Sbjct:  280 FRAYEEERVLTEFKESVVEVWRG-PQRFTTPGNEDAVRTQPGRVFEMPDGSNQMWREQRFKVSEGMWDETAAYNSTDEEGRVTKAQTIPALIKAALEGVDVDLRPNILGNVVVTGSTSLLNGFNDRLNHELAQMYPG-VKIKIHAAGLTTERRFGAWIGGSILASLGTFHQMWISRKEYDENGAGIVEKRC 468          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACTL8_HUMAN2.855e-2329.77Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=2... [more]
ARP4_EMENI1.085e-2238.96Actin-related protein 4 OS=Emericella nidulans GN=... [more]
ARP6_EMENI1.417e-2228.14Actin-like protein arp6 OS=Emericella nidulans GN=... [more]
ARP8_ORYSJ2.417e-2231.28Actin-related protein 8 OS=Oryza sativa subsp. jap... [more]
ARP8_ORYSI2.417e-2231.28Actin-related protein 8 OS=Oryza sativa subsp. ind... [more]
ARP4_ASPFU5.384e-2239.38Actin-related protein 4 OS=Aspergillus fumigatus G... [more]
ARP4_SCHPO7.032e-2229.44Actin-related protein 4 OS=Schizosaccharomyces pom... [more]
ARP6_ASPFU1.567e-2126.62Actin-like protein arp6 OS=Aspergillus fumigatus G... [more]
ARP4_GIBZE1.123e-1938.78Actin-related protein 4 OS=Gibberella zeae GN=ARP4... [more]
ARP4_NEUCR2.501e-1932.46Actin-related protein 4 OS=Neurospora crassa GN=ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top