EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_CHICK (Actin-related protein 5 OS=Gallus gallus GN=ACTR5 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.835e-16
Identity = 47/172 (27.33%), Postives = 85/172 (49.42%), Query Frame = 3
Query:  156 AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA-SLSTFQQMWISKGEYDESGPSIVHRKC 668
            +  + + D++    +  L  E++ E  K  ++V+  + L +   + +G ER R PE++FQPSLIG +  GI ET    + +   + +  L  N+ L+GG+ M+PG+  R+ KE+  + P     +V          W G    A    T ++ WI++ +Y+E G   +   C
Sbjct:  402 SSEQSLEDVESINEFEPLFAEEQPEAEKPVAAVQPVFNLAEYHQLFLGTERIRAPEIIFQPSLIGEDQTGIAETMQYVLERYSKEQQALLVQNVFLTGGNAMYPGLKARVQKELLEMRPFQSSFQVHLASSPTLDAWYGARDWAVEHMTREEGWITRKDYEEKGGEYLKEHC 573          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_CRYNE (Actin-like protein ARP6 OS=Cryptococcus neoformans GN=ARP6 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.191e-15
Identity = 61/261 (23.37%), Postives = 116/261 (44.44%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSS---SSVEKNYELPD---------------------------------------GQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMW-ISKGEYDESGPSIVHRK 665
            G   +H VPI +G  +   + R+D+ G+ LT+ L  +++ R   +    +  +V  ++E   YV+L+++ +LET K+    + + + Y LPD                                        Q++ +G ERF  PE+LF PS IG++  G+ ET    I +   ++R   + +I + GG      + +R+ +++ AL P   +I +    +     +   + L S   +   + +++ EY E G S+  RK
Sbjct:  158 GYSYTHVVPIRDGQIVWEHVKRIDVGGKLLTNHLKHLISFR--QWNMIDQTHVVNSVREACGYVSLNWKGDLETCKAKPRKNPIIQEYVLPDFSANSTSRTGYIRSGPNAAPPEETNGTGEVNGKQKPEEEEQVLWMGNERFAGPELLFHPSDIGLKQTGLPETIAYVISQMPEELRGMFWAHIGIIGGLGNIENLGERLERDLQALCPVEYEIGIYEAFDPASLAYTSATALTSSEVYMSTYPVTRTEYFEQGSSLCRRK 416          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_ARATH (Actin-related protein 5 OS=Arabidopsis thaliana GN=ARP5 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.087e-14
Identity = 52/168 (30.95%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  159 EREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELP---DGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKC---DVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            E E+ R +  +L  +   + Q++E   S +S E     P   +   I IG ERFRCPE+LF P+LIG++  G+ E    SI +    + ++ + L  +I+++GG ++ PG+ +R+   I  + P    I VV   +     W G S  A+   F     +K +YDE G
Sbjct:  410 EAELAR-LSSRLQEIDPTFVQKVEGELSQTSGEVPRVRPLTEEDYKIVIGIERFRCPEILFHPNLIGIDQVGLDEMAGTSIRRLPHDEKELEERLTSSILMTGGCSLLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFAANLNFLGNAFTKMDYDEKG 576          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_MOUSE (Actin-related protein 5 OS=Mus musculus GN=Actr5 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.422e-14
Identity = 44/143 (30.77%), Postives = 73/143 (51.05%), Query Frame = 3
Query:  246 SSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQ--MWISKGEYDESGPSIVHRKC 668
            ++V+  + L     +++G ER R PE++FQPSLIG E AGI ET +  + +    I+  L  N+ L+GG+ M+PG+  R+ KE+  + P     +V          W G    A L   +    W+++ +Y+E G   +   C
Sbjct:  429 TTVQPVFNLAAYHQLSVGTERIRAPEIIFQPSLIGEEQAGIAETLHFVLDRYPKAIQDTLVQNVFLTGGNVMYPGMKARVEKELLEMRPFQSSFQVQLASNPVLDAWYGARDWA-LDHLEDSGAWVTRKDYEEKGGEYLKEHC 570          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP4_DEBHA (Actin-related protein 4 OS=Debaryomyces hansenii GN=ARP4 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.051e-13
Identity = 39/107 (36.45%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  333 QPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVA---PPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            +PS    +  G+     +++   D+D+R  +  NI+++GG ++ P + +R+  E++   P  +KI++ A     ER    WIGGS+LASL TF QMW+SK EY+E+G
Sbjct:  377 KPSSKTSQIRGLTHLITHTLSTIDIDLRSSVAHNIIVTGGVSLIPQLTERLYSELSNSNPG-LKIRLHAVGNSSERFNQAWIGGSVLASLGTFHQMWVSKQEYEEAG 482          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_AEDAE (Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.498e-13
Identity = 40/117 (34.19%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  294 IGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            IG ER R PE+LFQPS+IG++ AG+  T    +     + +  L GN++L+GG     G  +R+S+E+ A+ P      ++         W G S  A+   F+Q  I++  YDE G
Sbjct:  510 IGVERIRVPEILFQPSMIGVQEAGLTGTIDYVLKLFPKEDQVKLVGNVMLTGGCANIRGFKERLSRELQAILPFQSVYNLMVAGSPSLDAWRGASQFANSQEFKQSLITRQLYDECG 626          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_KLULA (Actin-like protein ARP6 OS=Kluyveromyces lactis GN=ARP6 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.967e-13
Identity = 65/233 (27.90%), Postives = 97/233 (41.63%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGA--------------------ERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSV--WIGGSILASLSTFQQMWISKGEYDESG 644
            G   +  VPI +G     AI +LD+ GR LT  L + ++ R Y      E  +V ++KE+  +V  +        K ++ VE  Y LPD Q   +G                     E F  PE  F P +  +   GI ET    I  C   +R  L  NIV +GG+   P   +R+  E+    P     KV +P E+  S+  W      A+   F+   +++ EY E G
Sbjct:  172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVE--YVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_YEAST (Actin-like protein ARP6 OS=Saccharomyces cerevisiae GN=ARP6 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.793e-13
Identity = 62/227 (27.31%), Postives = 101/227 (44.49%), Query Frame = 3
Query:   33 VPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVA-LDYEQELETAKSSSSVE-------------------KNYELP-DGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPP-ERKYSVWIGGSILASLSTFQQMWISKGEYDESGP 647
            +P+ +G     A+ +LD+ GR LT  L + L+ R Y      E  +V ++KE+  +V+ + Y    +T K   ++E                   +N  LP D QIIT+  E F  PE  F P +  +   GI E    S+      +R  + GNIV +GG+   P  A R++ E+    P+     V  P  +     W   S  A   ++++  +++ EY E GP
Sbjct:  201 IPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD--ETILVNNIKEQCLFVSPVSYFDSFKT-KDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGP 424          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP6_CANGA (Actin-like protein ARP6 OS=Candida glabrata GN=ARP6 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.793e-13
Identity = 59/231 (25.54%), Postives = 98/231 (42.42%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPD-------------------GQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKV-VAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            G   +  +PI +G     A+ +LD+ GR L   L + ++ R Y      E  +V ++KE+  YV  D     E  K+    + ++ LPD                    QI+T+  ERF  PE  F P +      GI ET   SI      +R  +  NIV  GG+   PG  DR+  E+    P+    +  ++  ++  + W   +  A    +++  ++K +Y E G
Sbjct:  180 GFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDESILVNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ARP5_DROPS (Actin-related protein 5 OS=Drosophila pseudoobscura pseudoobscura GN=Arp5 PE=3 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.736e-12
Identity = 42/163 (25.77%), Postives = 79/163 (48.47%), Query Frame = 3
Query:  156 AEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESG 644
            A+ E + + ++ L++  ++++     A  + S  +NY+L        G E  R PE+LFQPS+IG   AG+ E     +       ++ +  ++ L+GG   F G+ +R+++E   + P   K  +    +   S W+G  + AS   F Q   ++ +Y E G
Sbjct:  478 ADNEQLLEFEKILSHYDVNFDDG--NAVQTQSAAENYQLH------FGVEDIRVPEILFQPSMIGSPEAGLAELIAFVLKLFTAQEQQRMVEHVYLTGGCAQFRGLKERLAREFLEMRPFQSKFSIYESDDHTLSAWLGACVQASQPNFGQTLTTRKDYQEHG 632          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ARP5_CHICK9.835e-1627.33Actin-related protein 5 OS=Gallus gallus GN=ACTR5 ... [more]
ARP6_CRYNE2.191e-1523.37Actin-like protein ARP6 OS=Cryptococcus neoformans... [more]
ARP5_ARATH1.087e-1430.95Actin-related protein 5 OS=Arabidopsis thaliana GN... [more]
ARP5_MOUSE2.422e-1430.77Actin-related protein 5 OS=Mus musculus GN=Actr5 P... [more]
ARP4_DEBHA2.051e-1336.45Actin-related protein 4 OS=Debaryomyces hansenii G... [more]
ARP5_AEDAE3.498e-1334.19Actin-related protein 5 OS=Aedes aegypti GN=Arp5 P... [more]
ARP6_KLULA5.967e-1327.90Actin-like protein ARP6 OS=Kluyveromyces lactis GN... [more]
ARP6_YEAST7.793e-1327.31Actin-like protein ARP6 OS=Saccharomyces cerevisia... [more]
ARP6_CANGA7.793e-1325.54Actin-like protein ARP6 OS=Candida glabrata GN=ARP... [more]
ARP5_DROPS1.736e-1225.77Actin-related protein 5 OS=Drosophila pseudoobscur... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top