EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: CLV1_ARATH (Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 5.321e-20
Identity = 71/209 (33.97%), Postives = 101/209 (48.33%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            KKL+ +   GN  +G +P S G++  SL+ L +    +SG  P  +                 TG +P  FG L KL+ L +A   L G  P  L +L  L  L L  N L+G IP  LS L SL+SL L  N+ T  IP +F +L +I   +   N L G +   IG L  L    + ENN +  +PA +G   +L  +D++ N L G
Sbjct:  168 KKLKYLSFGGNFFSGEIPESYGDIQ-SLEYLGLNGAGLSGKSPAFLSRLKNLREMYIGYYNSYTGGVPPEFGGLTKLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEAIGELPKLEVFEVWENNFTLQLPANLGRNGNLIKLDVSDNHLTG 375          

HSP 2 Score: 98.2117 bits (243), Expect = 6.949e-20
Identity = 75/249 (30.12%), Postives = 108/249 (43.37%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLA-FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            A+ F+G +P  + +L +L+ L + NN                +   L  +    N  NG LP  +  L   LK L  G    SG IP+S G               +G  P    RL+ L+ +Y+  +N   G  P E   L +L+ L +    L+G IP+ LSNL  L +L+L  N  T  IP     L  +   D S N L G +     NL  +  INL  NNL G +P  IG L  L++ ++  N
Sbjct:  103 ANNFTGELPLEMKSLTSLKVLNISNNGNLTGTFPGEILKAMVD---LEVLDTYNNNFNGKLPPEMSELK-KLKYLSFGGNFFSGEIPESYGDIQSLEYLGLNGAGLSGKSPAFLSRLKNLREMYIGYYNSYTGGVPPEFGGLTKLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEAIGELPKLEVFEVWEN 347          

HSP 3 Score: 98.2117 bits (243), Expect = 6.949e-20
Identity = 73/274 (26.64%), Postives = 117/274 (42.70%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTG-NPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFD------------------------FSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP + G++++LE+LGL                  +  K LR++ +   N   G +P   G L+  L+ L + +C+++G IP S+                TG IP     L  L+ L L+ N+L G  P    +LG +  + LF N L G IP  +  L  L    +  N FT  +P+      +++  D                         S+NF  GP+  ++G  K L  I + +N L+G +PA +  L  + I++L  N   G
Sbjct:  180 FSGEIPESYGDIQSLEYLGLNG-----AGLSGKSPAFLSRLKNLREMYIGYYNSYTGGVPPEFGGLT-KLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEAIGELPKLEVFEVWENNFTLQLPANLGRNGNLIKLDVSDNHLTGLIPKDLCRGEKLEMLILSNNFFFGPIPEELGKCKSLTKIRIVKNLLNGTVPAGLFNLPLVTIIELTDNFFSG 447          

HSP 4 Score: 95.9005 bits (237), Expect = 3.449e-19
Identity = 70/251 (27.89%), Postives = 115/251 (45.82%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNC-SISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            F+G +P  +  L+ L++L  G N+               + + L  +GL G  L+G  P+ +  L  +L+ +YIG   S +G +P   G               TG IPT+   L+ L  L+L  N L G  P EL  L  L  L L  N+L+G IP    NL ++  + L  N     IP     L  +  F+   N     L +++G    L+ +++S+N+L+G +P  +   + L+++ L+ N   GP
Sbjct:  156 FNGKLPPEMSELKKLKYLSFGGNFFSGEIPESY-----GDIQSLEYLGLNGAGLSGKSPAFLSRLK-NLREMYIGYYNSYTGGVPPEFGGLTKLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEAIGELPKLEVFEVWENNFTLQLPANLGRNGNLIKLDVSDNHLTGLIPKDLCRGEKLEMLILSNNFFFGP 400          

HSP 5 Score: 93.5893 bits (231), Expect = 1.712e-18
Identity = 67/232 (28.88%), Postives = 108/232 (46.55%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGG 712
            +G IP  +     LE L L NN+                CK L  I +  N LNG +P+ + NL + +  + + +   SG +P ++                +G IP   G    LQ L+L  N+  G+ P E+  L  L ++    N ++G IP  +S  ++L S+ L  NR    IP    ++K++   + S N L G + + IGN+  L  ++LS N+LSG +P  +GG
Sbjct:  374 TGLIPKDLCRGEKLEMLILSNNFFFGPIPEEL-----GKCKSLTKIRIVKNLLNGTVPAGLFNLPL-VTIIELTDNFFSGELPVTMSGDVLDQIYLSNNWF-SGEIPPAIGNFPNLQTLFLDRNRFRGNIPREIFELKHLSRINTSANNITGGIPDSISRCSTLISVDLSRNRINGEIPKGINNVKNLGTLNISGNQLTGSIPTGIGNMTSLTTLDLSFNDLSGRVP--LGG 596          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.949e-20
Identity = 75/249 (30.12%), Postives = 109/249 (43.78%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSI-GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG +  ++  L  L+ L L +N                N   L  + L+ N  +G+ PS I NL  SL+ L +   S  G IP S+                  G IP   G    ++ L LA N L GS P EL  L  L  L L  N+LSG++ S L  L++L  L + SN+F+  IP  F  L  + +F   SN   G +   + N + +  ++L  N LSG +      + +L  +DLA N   G
Sbjct:   99 SGKLSESVAKLDQLKVLNLTHN-----SLSGSIAASLLNLSNLEVLDLSSNDFSGLFPSLI-NLP-SLRVLNVYENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSG 340          

HSP 2 Score: 82.0333 bits (201), Expect = 5.154e-15
Identity = 62/245 (25.31%), Postives = 104/245 (42.45%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLA 742
            ++ SG I  ++ NL NLE L L +N                N   LR + +  N  +G++P+S+ N    ++ + +      G+IP  IG               +G IP    +L  L  L L  N+L G+   +L  L  L +L +  NK SG IP     L  L      SN F   +P +  + + I      +N L G +  +   +  L  ++L+ N+ SG +P+ +     L+ ++ A
Sbjct:  120 NSLSGSIAASLLNLSNLEVLDLSSN------DFSGLFPSLINLPSLRVLNVYENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFA 358          

HSP 3 Score: 82.0333 bits (201), Expect = 5.154e-15
Identity = 70/258 (27.13%), Postives = 105/258 (40.70%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            F   IP +  N ++L  L   N+                +C+ L+ + LT N     LPS       +LK L I +C + G +PQ +                +G IP   G L  L  L L+ N  +G  P  L  L  L        + S   P      T+   L           PS+F  +      D S N L G +  + G+L+ L  +NL  NNLSG++PA + G+  L+++DL++N L G     +V L
Sbjct:  362 FIAQIPESFKNFQSLTSLSFSNS---SIQNISSALEILQHCQNLKTLVLTLNFQKEELPSVPSLQFKNLKVLIIASCQLRGTVPQWLSNSPSLQLLDLSWNQLSGTIPPWLGSLNSLFYLDLSNNTFIGEIPHSLTSLQSLVSKENAVEEPSPDFPFFKKKNTNAGGLQYNQ-------PSSFPPM-----IDLSYNSLNGSIWPEFGDLRQLHVLNLKNNNLSGNIPANLSGMTSLEVLDLSHNNLSGNIPPSLVKL 604          

HSP 4 Score: 77.411 bits (189), Expect = 1.269e-13
Identity = 62/248 (25.00%), Postives = 108/248 (43.55%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            FSG  P+ I NL +L  L +  N                N  ++R+I L  N  +G +P  IGN S S++ L + + ++SG+IPQ +                +G + +  G+L  L  L ++ NK  G  PD    L +L       N  +G +P  LSN  S+  L L +N  +  I     ++ ++   D +SN   G + S++ N   L  IN ++      +P +    + L  +  + + ++
Sbjct:  146 FSGLFPSLI-NLPSLRVLNVYENSFHGLIPASLCN----NLPRIREIDLAMNYFDGSIPVGIGNCS-SVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFAKIKFIAQIPESFKNFQSLTSLSFSNSSIQ 387          

HSP 5 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 59/228 (25.88%), Postives = 94/228 (41.23%), Query Frame = 2
Query:    2 HASAFSGFIPNTI-GNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNL 682
            + ++F G IP ++  NL  +  + L  NY               NC  +  +GL  N L+G +P  +  LS +L  L + N  +SG +   +G               +G IP  F  L KL       N   G  P  L +   +  L L  N LSG I    S +T+L SL L SN F+  IPS   +   +   +F+    +  +     N + L  ++ S +++
Sbjct:  165 YENSFHGLIPASLCNNLPRIREIDLAMNYFDGSIPVGI-----GNCSSVEYLGLASNNLSGSIPQELFQLS-NLSVLALQNNRLSGALSSKLGKLSNLGRLDISSNKFSGKIPDVFLELNKLWYFSAQSNLFNGEMPRSLSNSRSISLLSLRNNTLSGQIYLNCSAMTNLTSLDLASNSFSGSIPSNLPNCLRLKTINFAKIKFIAQIPESFKNFQSLTSLSFSNSSI 386          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.449e-19
Identity = 75/251 (29.88%), Postives = 113/251 (45.02%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKD---ILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G +P     LR+L+ L L  N                   +L D+   GN L+G  P  +  L+M L+ L +     SG IP  IG               TGP+    G L+ L  + ++ N   G  PD + +  R+ KL + G  L G IPS +S+LTSL  L +         PS+F  LK+   I         ++GP+   IG+LK L  ++LS N LSG++P++   +K    + L  N+L G
Sbjct:  103 TGIVPPEFSKLRHLKVLDLSRNSLTGSIPKEWASM------RLEDLSFMGNRLSGPFPKVLTRLTM-LRNLSLEGNQFSGPIPPDIGQLVHLEKLHLPSNAFTGPLTEKLGLLKNLTDMRISDNNFTGPIPDFISNWTRILKLQMHGCGLDGPIPSSISSLTSLTDLRISD---LGGKPSSFPPLKNLESIKTLILRKCKIIGPIPKYIGDLKKLKTLDLSFNLLSGEIPSSFENMKKADFIYLTGNKLTG 343          

HSP 2 Score: 87.8113 bits (216), Expect = 9.392e-17
Identity = 55/155 (35.48%), Postives = 80/155 (51.61%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            TG +P  F +L+ L+ L L+ N L GS P E   + RL+ L   GN+LSG  P  L+ LT LR+L L  N+F+  IP     L  +      SN   GPL+  +G LK L  + +S+NN +G +P  I     +  + +    L+GP    I +L
Sbjct:  103 TGIVPPEFSKLRHLKVLDLSRNSLTGSIPKEWASM-RLEDLSFMGNRLSGPFPKVLTRLTMLRNLSLEGNQFSGPIPPDIGQLVHLEKLHLPSNAFTGPLTEKLGLLKNLTDMRISDNNFTGPIPDFISNWTRILKLQMHGCGLDGPIPSSISSL 256          

HSP 3 Score: 73.9442 bits (180), Expect = 1.403e-12
Identity = 63/223 (28.25%), Postives = 92/223 (41.26%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG---GLKDLQIMDLAYNRLEGPXLXXIVTL 787
            ++C  +R I L    L GI+P     L   LK L +   S++G+IP+                              +L+ L    N+L G FP  L  L  L  L L GN+ SG IP  +  L  L  L+L SN FT  +      LK++     S N   GP+   I N   +L + +    L G +P++I     L DL+I DL       P L  + ++
Sbjct:   88 SSCHVIR-IALKSQNLTGIVPPEFSKLR-HLKVLDLSRNSLTGSIPKEWAS-------------------------MRLEDLSFMGNRLSGPFPKVLTRLTMLRNLSLEGNQFSGPIPPDIGQLVHLEKLHLPSNAFTGPLTEKLGLLKNLTDMRISDNNFTGPIPDFISNWTRILKLQMHGCGLDGPIPSSISSLTSLTDLRISDLGGKPSSFPPLKNLESI 283          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: TMM_ARATH (Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.504e-19
Identity = 59/145 (40.69%), Postives = 79/145 (54.48%), Query Frame = 2
Query:  332 IPTTFGRL-QKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            IP   GRL   LQ L L  N  +G  PDEL +L  L  L L  N L+GSIP   +  + LRSL L  NR T  IP   + L  +   D + N L GP+   + +   L+ I+LS N ++G +P +I  L  L ++DL+YNRL GP
Sbjct:  150 IPAFLGRLGSSLQTLVLRENGFLGPIPDELGNLTNLKVLDLHKNHLNGSIPLSFNRFSGLRSLDLSGNRLTGSIPG--FVLPALSVLDLNQNLLTGPVPPTLTSCGSLIKIDLSRNRVTGPIPESINRLNQLVLLDLSYNRLSGP 292          

HSP 2 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 73/254 (28.74%), Postives = 116/254 (45.67%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYL-GSNRFTSVIP-STFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            + F G IP+ +GNL NL+ L L  N+                             LNG +P S    S  L++L +    ++G+IP  +                TGP+P T      L  + L+ N++ G  P+ +  L +L  L L  N+LSG  PS L  L SL++L L G+ +F++ IP + F  LK+++    S+  + G +   +  L  L  ++L  NNL+G++P     +K L  + L  N L GP
Sbjct:  169 NGFLGPIPDELGNLTNLKVLDLHKNH-----------------------------LNGSIPLSFNRFS-GLRSLDLSGNRLTGSIPGFV--LPALSVLDLNQNLLTGPVPPTLTSCGSLIKIDLSRNRVTGPIPESINRLNQLVLLDLSYNRLSGPFPSSLQGLNSLQALMLKGNTKFSTTIPENAFKGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHLEGNNLTGEIPLEFRDVKHLSELRLNDNSLTGP 390          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 95.5153 bits (236), Expect = 4.504e-19
Identity = 73/249 (29.32%), Postives = 116/249 (46.59%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSI-GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG +  ++G L  +  L L  N+               N K L+ + L+ N L+G +P+SI NL  +L++  + +   +G++P  I                  G   + FG+   L+ L L  N L G+ P++L HL RL+ L +  N+LSGS+   + NL+SL  L +  N F+  IP  F  L  + FF   +N  +G +   + N   L  +NL  N+LSG +      +  L  +DL  NR  G
Sbjct:   89 SGKLSESLGKLDEIRVLNLSRNFIKDSIPLSIF-----NLKNLQTLDLSSNDLSGGIPTSI-NLP-ALQSFDLSSNKFNGSLPSHICHNSTQIRVVKLAVNYFAGNFTSGFGKCVLLEHLCLGMNDLTGNIPEDLFHLKRLNLLGIQENRLSGSLSREIRNLSSLVRLDVSWNLFSGEIPDVFDELPQLKFFLGQTNGFIGGIPKSLANSPSLNLLNLRNNSLSGRLMLNCTAMIALNSLDLGTNRFNG 330          

HSP 2 Score: 88.9669 bits (219), Expect = 4.216e-17
Identity = 70/263 (26.62%), Postives = 104/263 (39.54%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLY------------LGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + F G +P +  N  +L +  L N+                +CK L  + LT N     LP         LK L + NC ++G++P+ +                TG IP+  G  + L  L L+ N   G  P  L  L  L    +  N+ S   P  +    S R+L             LG N  +  I   F +LK +  FD   N L G + S +  +  L  ++LS N LSG +P ++  L  L    +AYN L G
Sbjct:  350 NTFHGQVPESFKNFESLSYFSLSNS---SLANISSALGILQHCKNLTTLVLTLNFHGEALPDDSSLHFEKLKVLVVANCRLTGSMPRWLSSSNELQLLDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNEPSPDFPFFMKRNESARALQYNQIFGFPPTIELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKFSVAYNNLSG 609          

HSP 3 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 76/294 (25.85%), Postives = 109/294 (37.07%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKK---LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQ---KLQGLYLAFNKLVGSFPDELC-HLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLS------------------------------------ENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + F G IP ++ N  +L  L L NN                NC     L  + L  N  NG LP ++ +    LK + +   +  G +P+S                    I +  G LQ    L  L L  N    + PD+   H  +L  LV+   +L+GS+P  LS+   L+ L L  NR T  IPS     K + + D S+N   G +   +  L+ L   N+S                                     NNLSG +    G LK L + DL +N L G
Sbjct:  278 NGFIGGIPKSLANSPSLNLLNLRNN--------SLSGRLMLNCTAMIALNSLDLGTNRFNGRLPENLPDCKR-LKNVNLARNTFHGQVPESFKNFESLSYFSLSNSSLAN-ISSALGILQHCKNLTTLVLTLNFHGEALPDDSSLHFEKLKVLVVANCRLTGSMPRWLSSSNELQLLDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNEPSPDFPFFMKRNESARALQYNQIFGFPPTIELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSG 561          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5977_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.883e-19
Identity = 73/233 (31.33%), Postives = 110/233 (47.21%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYI-GNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLF---GNKLSGSIPSC-------LSNLTSLRSLYLGSNRFTSVIPSTFWSLK-DILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG--PXLXXIVTL 787
            N  ++  I LT   L G LP+ I  LS  L+TL + GN  +SG +P +IG                GPIP + G L++L  L L  NK  G+ P     +GRL KL  F    N+L G +P         L  L      + G+N+ +  IP   +S +  +L   F  N   G +   +G ++ L  + L  N LSGD+P+++  L +LQ + L+ N+  G  P L  + +L
Sbjct:   66 NDNRVVSISLTNRNLKGKLPTEISTLS-ELQTLDLTGNPELSGPLPANIGNLRKLTFLSLMGCAFNGPIPDSIGNLEQLTRLSLNLNKFSGTIP---ASMGRLSKLYWFDIADNQLEGKLPVSDGASLPGLDMLLQTGHFHFGNNKLSGEIPEKLFSSEMTLLHVLFDGNQFTGSIPESLGLVQNLTVLRLDRNRLSGDIPSSLNNLTNLQELHLSDNKFTGSLPNLTSLTSL 294          

HSP 2 Score: 87.4261 bits (215), Expect = 1.227e-16
Identity = 78/253 (30.83%), Postives = 112/253 (44.27%), Query Frame = 2
Query:   11 AFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILP----SSIGNLSMSLKT--LYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFL-VGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            AF+G IP++IGNL  L  L L  N                   KL    +  N L G LP    +S+  L M L+T   + GN  +SG IP+ +                       F     L  +    N+  GS P+ L  +  L  L L  N+LSG IPS L+NLT+L+ L+L  N+FT  +P+   SL  +   D S+N L + P+ S I  L  L  + L +  L G +P ++     LQ + L +N
Sbjct:  128 AFNGPIPDSIGNLEQLTRLSLNLN-----KFSGTIPASMGRLSKLYWFDIADNQLEGKLPVSDGASLPGLDMLLQTGHFHFGNNKLSGEIPEKL-----------------------FSSEMTLLHVLFDGNQFTGSIPESLGLVQNLTVLRLDRNRLSGDIPSSLNNLTNLQELHLSDNKFTGSLPN-LTSLTSLYTLDVSNNPLALSPVPSWIPFLNSLSTLRLEDIQLDGPVPTSLFSPLQLQTVSLKHN 351          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 7.683e-19
Identity = 77/275 (28.00%), Postives = 113/275 (41.09%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLG------------------------SNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +  +G +P  IGNL  ++W+  G N                              L+G +P  IG L+  L+ L I + + SG+IP  IG               +G IP +F  L +L+  ++A  ++    PD +    +L  L + G  LSG IPS  SNLTSL  L LG                        +N  T  IPST      +   D S N L GP+ + + NL  L  + L  N L+G  P      + L+ +D++YN L G
Sbjct:  133 NVLTGSLPPAIGNLTRMQWMTFGIN-----------------------------ALSGPVPKEIGLLT-DLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQ--KTQSLRNVDVSYNDLSG 375          

HSP 2 Score: 93.5893 bits (231), Expect = 1.712e-18
Identity = 65/210 (30.95%), Postives = 107/210 (50.95%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTF---WSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            L ++ L  N L G LP +IGNL+  ++ +  G  ++SG +P+ IG               +G IP   GR  KLQ +Y+  + L G  P    +L +L++  +   +++  IP  + + T L +L +     +  IPS+F    SL ++   D SS         D+ +L VL+   L  NNL+G +P+TIG    L+ +DL++N+L GP
Sbjct:  125 LTNLNLGQNVLTGSLPPAIGNLTR-MQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLV---LRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGP 330          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5694_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.003e-18
Identity = 75/250 (30.00%), Postives = 114/250 (45.60%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNK-LVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFW-SLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG I ++I +L  L  L L  N+              + C  L  + L+ N + G +P  I   S SLK +   +  + G IP+ +G               TG +P   G+L +L  L L+ N  LV   P  L  L +L++L+L  +   G IP+    LTSLR+L L  N  +  IP +   SLK+++  D S N L G   S I + K L+ ++L  N   G +P +IG    L+ + +  N   G
Sbjct:   88 SGEISDSICDLPYLTHLDLSLNFFNQPIPLQL-----SRCVTLETLNLSSNLIWGTIPDQISEFS-SLKVIDFSSNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPAIGKLSELVVLDLSENSYLVSEIPSFLGKLDKLEQLLLHRSGFHGEIPTSFVGLTSLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSG 331          

HSP 2 Score: 88.5817 bits (218), Expect = 5.506e-17
Identity = 70/249 (28.11%), Postives = 103/249 (41.37%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNP-LNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFG-RLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP  +G L NL+ L LG+N                   +L  + L+ N  L   +PS +G L   L+ L +      G IP S                 +G IP + G  L+ L  L ++ NKL GSFP  +C   RL  L L  N   GS+P+ +    SL  L + +N F+   P   W L  I      +N   G +   +     L  + +  N+ SG++P  +G +K L     + NR  G
Sbjct:  161 GMIPEDLGLLFNLQVLNLGSNLLTGIVPPAI-----GKLSELVVLDLSENSYLVSEIPSFLGKLD-KLEQLLLHRSGFHGEIPTSFVGLTSLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVLWKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSG 403          

HSP 3 Score: 84.7297 bits (208), Expect = 7.951e-16
Identity = 60/203 (29.56%), Postives = 92/203 (45.32%), Query Frame = 2
Query:  224 TLYIGNCSI-----SGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSN-FLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE-------GPXLXXIVTLIV 793
            TLY+ + ++     SG I  SI                  PIP    R   L+ L L+ N + G+ PD++     L  +    N + G IP  L  L +L+ L LGSN  T ++P     L +++  D S N +LV  + S +G L  L  + L  +   G++P +  GL  L+ +DL+ N L        GP L  +V+L V
Sbjct:   74 TLYVSSINLQSLNLSGEISDSICDLPYLTHLDLSLNFFNQPIPLQLSRCVTLETLNLSSNLIWGTIPDQISEFSSLKVIDFSSNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPAIGKLSELVVLDLSENSYLVSEIPSFLGKLDKLEQLLLHRSGFHGEIPTSFVGLTSLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDV 276          

HSP 4 Score: 79.337 bits (194), Expect = 3.340e-14
Identity = 66/235 (28.09%), Postives = 101/235 (42.98%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATI 706
            H++ F G +PN+IG   +LE L + NN                   +++ I    N   G +P S+ +L+ +L+ + I N S SG IP  +G                         ++ L     + N+  G  P   C    L  + +  N+L G IP  L N   L SL L  N FT  IP +   L  + + D S N L G +   + NLK+ L  N+S N LSG++P ++
Sbjct:  301 HSNFFEGSLPNSIGECLSLERLQVQNN-----GFSGEFPVVLWKLPRIKIIRADNNRFTGQVPESV-SLASALEQVEIVNNSFSGEIPHGLGL------------------------VKSLYKFSASQNRFSGELPPNFCDSPVLSIVNISHNRLLGKIPE-LKNCKKLVSLSLAGNAFTGEIPPSLADLHVLTYLDLSDNSLTGLIPQGLQNLKLAL-FNVSFNGLSGEVPHSL 503          

HSP 5 Score: 69.3218 bits (168), Expect = 3.457e-11
Identity = 48/138 (34.78%), Postives = 65/138 (47.10%), Query Frame = 2
Query:  335 PTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            PT +     LQ L L+     G   D +C L  L  L L  N  +  IP  LS   +L +L L SN     IP        +   DFSSN + G +  D+G L  L  +NL  N L+G +P  IG L +L ++DL+ N
Sbjct:   73 PTLYVSSINLQSLNLS-----GEISDSICDLPYLTHLDLSLNFFNQPIPLQLSRCVTLETLNLSSNLIWGTIPDQISEFSSLKVIDFSSNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPAIGKLSELVVLDLSEN 205          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5343_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.311e-18
Identity = 71/242 (29.34%), Postives = 107/242 (44.21%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDI-----------LFFDFSS-------------NFLV-GPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIV 781
            N  +LR+I L+ N LNG +P+++  + + + ++ IGN  +SG  P  +G               TGP+P   G L+ L+ L L+ N   G  P+ L +L  L +  + GN LSG IP  + N T L  L L        IP +  +L ++             F F               N L+ GP+   IG++  L  ++LS N L+G +P T   L     M L  N L GP    I+
Sbjct:  112 NLTRLREIDLSRNFLNGTIPTTLSQIPLEILSV-IGN-RLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMKMKRLVLRNCLIRGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFII 351          

HSP 2 Score: 84.7297 bits (208), Expect = 7.951e-16
Identity = 68/225 (30.22%), Postives = 103/225 (45.78%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAF--NKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLS 685
            SG  P  +G++  L  + L  N                N + L+++ L+ N   G +P S+ NL  +L    I   S+SG IP  IG                GPIP +   L  L  L +     +   SFPD L +L ++ +LVL    + G IP  + +++ L++L L SN  T VIP TF +L    F   ++N L GP+   I N K    ++LS+NN +
Sbjct:  150 SGPFPPQLGDITTLTDVNLETNLFTGPLPRNL-----GNLRSLKELLLSANNFTGQIPESLSNLK-NLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPD-LRNLMKMKRLVLRNCLIRGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKE--NLDLSDNNFT 365          

HSP 3 Score: 79.7221 bits (195), Expect = 2.558e-14
Identity = 49/146 (33.56%), Postives = 76/146 (52.05%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            G  P  FG L +L+ + L+ N L G+ P  L  +  L+ L + GN+LSG  P  L ++T+L  + L +N FT  +P    +L+ +     S+N   G +   + NLK L    +  N+LSG +P  IG    L+ +DL    +EGP
Sbjct:  104 GIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIP-LEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGP 248          

HSP 4 Score: 77.0258 bits (188), Expect = 1.658e-13
Identity = 53/168 (31.55%), Postives = 80/168 (47.62%), Query Frame = 2
Query:  245 SISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG---GLKDLQIMDL 739
            S+ G  P   G                G IPTT  ++  L+ L +  N+L G FP +L  +  L  + L  N  +G +P  L NL SL+ L L +N FT  IP +  +LK++  F    N L G +   IGN  +L  ++L   ++ G +P +I     L +L+I DL
Sbjct:  101 SLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIP-LEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDL 267          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PII2_ARATH (Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.235e-18
Identity = 51/141 (36.17%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            G +P T G L KL+ L +  N   G  P  +C+L RL +LV  GN  +G IP+C   L  L  L L  N F+  +P++F  L  +L  D S+N L G L  ++G LK L  ++L  N  SG +   I  ++ L  + L+ N
Sbjct:  157 GELPETIGNLTKLKSLVVLENGFSGELPASICNLKRLKRLVFAGNSFAGMIPNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNLTLLDLRNNRFSGGLSKNIENIQSLTELVLSNN 297          

HSP 2 Score: 85.8853 bits (211), Expect = 3.569e-16
Identity = 59/192 (30.73%), Postives = 94/192 (48.96%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRF--TSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA 700
            N  KL+ + +  N  +G LP+SI NL    + ++ GN S +G IP                   +G +PT+FG L  L  L L+ N L G+ P EL  L  L  L L  N+ SG +   + N+ SL  L L +N      ++ + +  + +++  D S   L G + + + NLK L  + L+ NNL+G +P+
Sbjct:  165 NLTKLKSLVVLENGFSGELPASICNLKRLKRLVFAGN-SFAGMIPNCFKGLKELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNLTLLDLRNNRFSGGLSKNIENIQSLTELVLSNNPMGEEDMVGTNWGKMSNLVVLDLSKMGLRGEIPTSLTNLKRLRFLGLNNNNLTGFVPS 355          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
CLV1_ARATH5.321e-2033.97Receptor protein kinase CLAVATA1 OS=Arabidopsis th... [more]
PSKR1_DAUCA6.949e-2030.12Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
Y1765_ARATH3.449e-1929.88Probable LRR receptor-like serine/threonine-protei... [more]
TMM_ARATH4.504e-1940.69Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN... [more]
PSKR1_ARATH4.504e-1929.32Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
Y5977_ARATH5.883e-1931.33Probable leucine-rich repeat receptor-like protein... [more]
Y1561_ARATH7.683e-1928.00Probable LRR receptor-like serine/threonine-protei... [more]
Y5694_ARATH1.003e-1830.00Probably inactive leucine-rich repeat receptor-lik... [more]
Y5343_ARATH1.311e-1829.34Probable LRR receptor-like serine/threonine-protei... [more]
PII2_ARATH2.235e-1836.17Piriformospora indica-insensitive protein 2 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top