EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP1_ORYSJ (Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.021e-15
Identity = 66/197 (33.50%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  173 LNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            L+G +P+ +  LS +L+ L I + ++SG IP S+                TGPIP +F  L  L+ L L  NKL G  P  L   G+   L+L  N+L+G IP   +    + ++ L  NR T      F + + I   D S N L   LS  +   + L  ++LS N + G +P ++  L  LQ +DL+YNRL GP
Sbjct:  108 LSGPIPACLTALS-NLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGCIPAGLVQ-GQFRSLILSYNQLTGPIPRDDAQ-DEINTVDLSHNRLTGDASFLFAAGRPIGKVDLSWNDLDFDLSKLVFPPE-LTYLDLSHNRIRGTVPRSLAALSTLQTLDLSYNRLCGP 300          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4294_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.946e-15
Identity = 73/254 (28.74%), Postives = 107/254 (42.13%), Query Frame = 2
Query:   14 FSGFIPNTI--GNLRNLEWLGL-GNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDEL-CHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            FSG +PN +  G+   L  L L GNN                    L  + L+ N L G LP   G   +    L + N    GN+ +                  TG  P    +L +   L L++NKL GS P+ +  H  +L  L +  N L G IP  L ++ +L  ++L +N  T  I     S   I   D S N   G L    G+L  L  +NL+ NNLSG +P+++  +  L  +D++ N   GP
Sbjct:  306 FSGSLPNNLLKGDSLLLTTLDLSGNNLSGPVSSIMSTT--------LHTLDLSSNSLTGELPLLTGGCVL----LDLSNNQFEGNLTRW-SKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLPSSMNDIVSLSSLDVSQNHFTGP 546          

HSP 2 Score: 82.0333 bits (201), Expect = 5.154e-15
Identity = 50/139 (35.97%), Postives = 69/139 (49.64%), Query Frame = 2
Query:  344 FGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F  L KL  L ++ N L G  P++L     L  L L  N  S S+P  +    SLR+L L  N F+  IP +   L  +   D SSN L GPL   +  L  LL +NLS N  +G MP     +  L+++DL  N ++G
Sbjct:   74 FSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEVLDLHGNSIDG 212          

HSP 3 Score: 81.6481 bits (200), Expect = 6.731e-15
Identity = 67/255 (26.27%), Postives = 113/255 (44.31%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTS----VIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ SG +PN +G+ ++L++L L +N                               +  LP  IG  S+SL+ L +   + SG IP+S+G               +GP+P +  RL  L  L L+ N   G  P     +  L+ L L GN + G++      LT+   + +  NR  +    ++P    S+K +   + S N L G L+S     + L  ++LS N LSG++P     + DL+++ L+ NR  G
Sbjct:   88 NSLSGVLPNDLGSFKSLQFLDLSDNL-----------------------------FSSSLPKEIGR-SVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEVLDLHGNSIDGNLDGEFFLLTNASYVDISGNRLVTTSGKLLPGVSESIKHL---NLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELPG-FNYVYDLEVLKLSNNRFSG 308          

HSP 4 Score: 75.8702 bits (185), Expect = 3.693e-13
Identity = 45/128 (35.16%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  383 FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIP-SCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            FN    S+   +C+ G +  +VL    L+     S  SNLT L  L + +N  + V+P+   S K + F D S N     L  +IG    L  ++LS NN SG++P ++GGL  LQ +D++ N L GP
Sbjct:   38 FNGCPSSWNGIVCNGGNVAGVVLDNLGLTADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGP 165          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.731e-15
Identity = 44/121 (36.36%), Postives = 68/121 (56.20%), Query Frame = 2
Query:  338 TTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA 700
            T   + +++  L L ++K++G  P ++  L  L  L+L  N L G+IP+ L N T+L  ++L SN FT  IP+    L  +   D SSN L GP+ + +G LK L   N+S N L G +P+
Sbjct:   68 TCDAKTKRVITLNLTYHKIMGPLPPDIGKLDHLRLLMLHNNALYGAIPTALGNCTALEEIHLQSNYFTGPIPAEMGDLPGLQKLDMSSNTLSGPIPASLGQLKKLSNFNVSNNFLVGQIPS 188          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1143_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g14390 OS=Arabidopsis thaliana GN=At1g14390 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.148e-14
Identity = 69/207 (33.33%), Postives = 99/207 (47.83%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGS-IPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L+ + L    ++G LPS I  LS SL++L + +  ISGNIP+ I                          L+ L+ L LA N   GS PD L  L  L +L L GNKL    +PS  SNL ++    L +N F S IP     L  +   D SSN   G +   + +L  L  ++L++N LSG +P +      L+I+D++ N L G
Sbjct:  109 LKTLSLVSLGISGPLPSQIIRLSSSLQSLNLSSNFISGNIPKEI------------------------SSLKNLRSLVLANNLFNGSVPD-LRGLSNLQELNLGGNKLGPEVVPSLASNLITIS---LKNNSFGSKIPEQIKKLNKLQSLDLSSNKFTGSIPRFLLSLPSLQNLSLAQNLLSGSLPNSSLCNSKLRILDVSRNLLTG 287          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP_PYRCO (Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.558e-14
Identity = 62/180 (34.44%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  224 TLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWS-LKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            T++ G   +SG IP  +G                TGPI     +L+ L+ L L++  L GS PD L  L  L  L L  N L+G+IPS LS L +L +L L  N+ T  IP +F   + ++     S N L G + +    +     I+LS N L GD     G  K  QI+DL+ N LE
Sbjct:   76 TIFAGQ--VSGQIPALVGDLPYLETLEFHKQPNLTGPIQPAIAKLKGLKSLRLSWTNLSGSVPDFLSQLKNLTFLDLSFNNLTGAIPSSLSELPNLGALRLDRNKLTGHIPISFGQFIGNVPDLYLSHNQLSGNIPTSFAQMD-FTSIDLSRNKLEGDASVIFGLNKTTQIVDLSRNLLE 252          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP_VITVI (Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.340e-14
Identity = 64/231 (27.71%), Postives = 99/231 (42.86%), Query Frame = 2
Query:  140 KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLT-SLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLS-----------------------SDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  + +    L+G +P ++G+L      ++    +++G IP +I                +GP+P  F  L+ L  L L+FN L G  P  L  L  L  L L  N L+G IP        S   L+L  N+ +  IP +F    D    D S N L G LS                       S +   K L  ++LS N ++G +P  +  L DLQ ++++YNRL G
Sbjct:   74 RINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGF-DPNVMDLSRNKLEGDLSIFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEMMTSL-DLQFLNVSYNRLCG 302          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP2_ARATH (Polygalacturonase inhibitor 2 OS=Arabidopsis thaliana GN=PGIP2 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.698e-14
Identity = 60/180 (33.33%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  224 TLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLK-DILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            +L I +  ISG IP  +G                TG I  T  +L+ L  L L++  L G  P+ L  L  L+ + L  N LSGSIPS LS+L  L  L L  N+ T  IP +F +    +     S N L G +   +GN      I+LS N L GD     G  K   I+D++ N  +
Sbjct:   74 SLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGN-PDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQ 252          

HSP 2 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 54/197 (27.41%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  173 LNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLT-SLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++G +P  +G+L      ++    +++G+I  +I                TGP+P    +L+ L+ + L+FN L GS P  L  L +L+ L L  NKL+G IP      +  + SL+L  N+ +  IP +  +  D    D S N L G  S   G  K    +++S N    D+ + +   K L  +D+ +N + G
Sbjct:   82 ISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGN-PDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDL-SKVKLAKTLNNLDMNHNGITG 276          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.719e-14
Identity = 52/131 (39.69%), Postives = 74/131 (56.49%), Query Frame = 2
Query:  326 GPIP-TTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSS-DIGNLKVLLGINLSENNLSGDMPATIGG 712
            GPIP  T G+L+ L+ L L  N L G+ P ++  L  LD + L  N  SG +PS +S    L  L L  N FT  IP+TF +LK +      +N L GP+ + D  +L+ L   NLS N+L+G +P+ +GG
Sbjct:  101 GPIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPSFVSR--QLNILDLSFNSFTGKIPATFQNLKQLTGLSLQNNKLSGPVPNLDTVSLRRL---NLSNNHLNGSIPSALGG 226          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RKF1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.658e-13
Identity = 60/230 (26.09%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSE------------------------NNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            LR+I L  N +NG LP    + +++  +L +   S                          G IP  FG    L  L L  N   G+ P EL +L  L KL+L  NKL+G++P+ L+ L ++    +   + +  IPS   + K +   +  ++ L GP+ S I  L  L+ + +S+                         N+SG +P  +  LK+L+ +DL++N+L G
Sbjct:  125 LREIDLAYNYINGTLPREWASSNLTFISLLVNRLS--------------------------GEIPKEFGN-SSLTYLDLESNAFSGTIPQELGNLVHLKKLLLSSNKLTGTLPASLARLQNMTDFRINDLQLSGTIPSYIQNWKQLERLEMIASGLTGPIPSVISVLSNLVNLRISDIRGPVQPFPSLKNVTGLTKIILKNCNISGQIPTYLSHLKELETLDLSFNKLVG 327          

HSP 2 Score: 72.0182 bits (175), Expect = 5.333e-12
Identity = 67/228 (29.39%), Postives = 101/228 (44.30%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLA-FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            SG IP   GN  +L +L L +N                N   L+ + L+ N L G LP+S+  L  ++    I +  +SG IP  I                TGPIP+    L  L  L ++     V  FP  L ++  L K++L    +SG IP+ LS+L  L +L L  N+    IPS F   +++ F   + N L G    ++  L+  + ++LS NNL    P
Sbjct:  159 SGEIPKEFGN-SSLTYLDLESN-----AFSGTIPQELGNLVHLKKLLLSSNKLTGTLPASLARLQ-NMTDFRINDLQLSGTIPSYIQNWKQLERLEMIASGLTGPIPSVISVLSNLVNLRISDIRGPVQPFPS-LKNVTGLTKIILKNCNISGQIPTYLSHLKELETLDLSFNKLVGGIPS-FAQAENLRFIILAGNMLEGDAPDEL--LRDGITVDLSYNNLKWQSP 375          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5020_ARATH (Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 61/219 (27.85%), Postives = 93/219 (42.47%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL---------FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N   L  + L+ N L+G LPSS  + S+    + +   + SG++                    +G +P       +L  L +  N + GS P  L    +   + L  NK SG IP       SLRSL L  N     IP       ++L           D S+N L G L  DIG ++ +  +NL+ N LSG++P+ +  L  L  +DL+ N  +G
Sbjct:  317 NSSTLTMLNLSSNGLSGDLPSSFKSCSV----IDLSGNTFSGDVSVVQKWEATPDVLDLSSNNLSGSLPNFTSAFSRLSVLSIRNNSVSGSLPS-LWGDSQFSVIDLSSNKFSGFIPVSFFTFASLRSLNLSRNNLEGPIPFRGSRASELLVLNSYPQMELLDLSTNSLTGMLPGDIGTMEKIKVLNLANNKLSGELPSDLNKLSGLLFLDLSNNTFKG 530          

HSP 2 Score: 70.8626 bits (172), Expect = 1.188e-11
Identity = 56/191 (29.32%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  152 IGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFP------DELCHLG---RLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            + L+ N L+G LP+     S  L  L I N S+SG++P S+                +G IP +F     L+ L L+ N L G  P       EL  L    +++ L L  N L+G +P  +  +  ++ L L +N+ +  +PS    L  +LF D S+N   G + + + +   ++G N+S N+LSG +P
Sbjct:  369 LDLSSNNLSGSLPNFTSAFSR-LSVLSIRNNSVSGSLP-SLWGDSQFSVIDLSSNKFSGFIPVSFFTFASLRSLNLSRNNLEGPIPFRGSRASELLVLNSYPQMELLDLSTNSLTGMLPGDIGTMEKIKVLNLANNKLSGELPSDLNKLSGLLFLDLSNNTFKGQIPNKLPS--QMVGFNVSYNDLSGIIP 555          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
PGIP1_ORYSJ3.021e-1533.50Polygalacturonase inhibitor 1 OS=Oryza sativa subs... [more]
Y4294_ARATH3.946e-1528.74Probable LRR receptor-like serine/threonine-protei... [more]
FEI1_ARATH6.731e-1536.36LRR receptor-like serine/threonine-protein kinase ... [more]
Y1143_ARATH1.148e-1433.33Probable LRR receptor-like serine/threonine-protei... [more]
PGIP_PYRCO2.558e-1434.44Polygalacturonase inhibitor OS=Pyrus communis GN=P... [more]
PGIP_VITVI3.340e-1427.71Polygalacturonase inhibitor OS=Vitis vinifera GN=p... [more]
PGIP2_ARATH5.698e-1433.33Polygalacturonase inhibitor 2 OS=Arabidopsis thali... [more]
Y5830_ARATH9.719e-1439.69Probable inactive receptor kinase At5g58300 OS=Ara... [more]
RKF1_ARATH1.658e-1326.09Probable LRR receptor-like serine/threonine-protei... [more]
Y5020_ARATH2.165e-1327.85Probable inactive receptor kinase At5g10020 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top