EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: SRF5_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana GN=SRF5 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.701e-11
Identity = 47/141 (33.33%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  134 CK--KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVI 550
            CK   + ++ L+G  L G     + NL  SL T  +   ++ GNIP  +                 G +P +  +++ LQ + L  NKL G  PD    L +L+ L    NKLSG +P   +NLTSL+ L+L  NRFT  I
Sbjct:   65 CKGSSVTELQLSGFELGGSRGYLLSNLK-SLTTFDLSKNNLKGNIPYQL--PPNIANLDFSENELDGNVPYSLSQMKNLQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQDNRFTGDI 202          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
SRF5_ARATH7.701e-1133.33Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top