EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_NEMVE (Ubiquitin-conjugating enzyme E2 S OS=Nematostella vectensis GN=v1g237158 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.498e-12
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F + +    D+P  PPK  F TK+FHPN+  NG IC++ LK+ W P L I +++
Sbjct:   61 GIFKIKLVLGKDFPAAPPKGFFLTKIFHPNVAKNGEICVNTLKKDWKPDLGIKQVL 116          

HSP 2 Score: 33.113 bits (74), Expect = 2.498e-12
Identity = 15/42 (35.71%), Postives = 23/42 (54.76%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            K++ +E+  L  DPP         ED+   QA+I GP+ +PY
Sbjct:   17 KQVAREIHGLTNDPPEGIKVFSNDEDITDIQASIEGPTGTPY 58          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2L3_PONAB (Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.608e-12
Identity = 27/58 (46.55%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKMVK 508
            G F + INFP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    ++++
Sbjct:   49 GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQ 106          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2L3_MOUSE (Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus GN=Ube2l3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.608e-12
Identity = 27/58 (46.55%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKMVK 508
            G F + INFP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    ++++
Sbjct:   49 GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQ 106          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2L3_HUMAN (Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens GN=UBE2L3 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.608e-12
Identity = 27/58 (46.55%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKMVK 508
            G F + INFP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    ++++
Sbjct:   49 GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQ 106          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2L3_BOVIN (Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.608e-12
Identity = 27/58 (46.55%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKMVK 508
            G F + INFP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    ++++
Sbjct:   49 GAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQ 106          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROPS (Ubiquitin-conjugating enzyme E2 S OS=Drosophila pseudoobscura pseudoobscura GN=GA22810 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.240e-12
Identity = 25/56 (44.64%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F V +    D+P  PPK  F TK+FHPN+  NG IC++ LK+ W P L I  ++
Sbjct:   61 GIFRVKLTLSKDFPQTPPKAYFLTKIFHPNVAGNGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 3.240e-12
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DROPE (Ubiquitin-conjugating enzyme E2 S OS=Drosophila persimilis GN=GL16001 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.240e-12
Identity = 25/56 (44.64%), Postives = 35/56 (62.50%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F V +    D+P  PPK  F TK+FHPN+  NG IC++ LK+ W P L I  ++
Sbjct:   61 GIFRVKLTLSKDFPQTPPKAYFLTKIFHPNVAGNGEICVNTLKKDWKPDLGIKHIL 116          

HSP 2 Score: 30.8018 bits (68), Expect = 3.240e-12
Identity = 13/43 (30.23%), Postives = 25/43 (58.14%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +++++EL++++  PP          D+   QA I GP+ +PYA
Sbjct:   17 RQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYA 59          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2K_MOUSE (Ubiquitin-conjugating enzyme E2 K OS=Mus musculus GN=Ube2k PE=2 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 3.247e-12
Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+
Sbjct:   54 GRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTL 106          

HSP 2 Score: 25.0238 bits (53), Expect = 3.247e-12
Identity = 15/48 (31.25%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTS---CSAGPAAEDMFHWQATIMGPSDSPY 326
            +A +RI +E K++ K   TS          E+    +  I GP D+PY
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPY 51          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2K_HUMAN (Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens GN=UBE2K PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 3.247e-12
Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+
Sbjct:   54 GRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTL 106          

HSP 2 Score: 25.0238 bits (53), Expect = 3.247e-12
Identity = 15/48 (31.25%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTS---CSAGPAAEDMFHWQATIMGPSDSPY 326
            +A +RI +E K++ K   TS          E+    +  I GP D+PY
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPY 51          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2K_BOVIN (Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN=UBE2K PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 3.247e-12
Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G + + I  P  YPF PPKV F TK++HPNI+S  G+ICLDILK+QW+ A+T+
Sbjct:   54 GRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTL 106          

HSP 2 Score: 25.0238 bits (53), Expect = 3.247e-12
Identity = 15/48 (31.25%), Postives = 23/48 (47.92%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTS---CSAGPAAEDMFHWQATIMGPSDSPY 326
            +A +RI +E K++ K   TS          E+    +  I GP D+PY
Sbjct:    4 IAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPY 51          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBE2S_NEMVE2.498e-1242.86Ubiquitin-conjugating enzyme E2 S OS=Nematostella ... [more]
UB2L3_PONAB2.608e-1246.55Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii... [more]
UB2L3_MOUSE2.608e-1246.55Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus... [more]
UB2L3_HUMAN2.608e-1246.55Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens... [more]
UB2L3_BOVIN2.608e-1246.55Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus G... [more]
UBE2S_DROPS3.240e-1244.64Ubiquitin-conjugating enzyme E2 S OS=Drosophila ps... [more]
UBE2S_DROPE3.240e-1244.64Ubiquitin-conjugating enzyme E2 S OS=Drosophila pe... [more]
UBE2K_MOUSE3.247e-1256.60Ubiquitin-conjugating enzyme E2 K OS=Mus musculus ... [more]
UBE2K_HUMAN3.247e-1256.60Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens ... [more]
UBE2K_BOVIN3.247e-1256.60Ubiquitin-conjugating enzyme E2 K OS=Bos taurus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top