EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBCX_DICDI (Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostelium discoideum GN=pex4 PE=3 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.311e-12
Identity = 26/58 (44.83%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKMVK 508
            G F + I+ P +YP +PP + F TK+FHPNI+   G ICLD+LK  WS   T+  + +
Sbjct:   48 GKFELDISVPTNYPLQPPTIKFVTKIFHPNIHFKTGEICLDLLKTSWSAIYTLQSVCR 105          

HSP 2 Score: 33.113 bits (74), Expect = 3.311e-12
Identity = 17/42 (40.48%), Postives = 23/42 (54.76%), Query Frame = 3
Query:  204 RILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            R++KE K LQ +        P  E D++ W A I GP D+PY
Sbjct:    4 RLMKEYKVLQNEEFEDILLYPRDESDLYRWVAIIKGPPDTPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_DROME (Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.406e-12
Identity = 43/95 (45.26%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +   N  PF        GVF + +  P DYP   PKV F TK++HPNI+  G ICLD+LK++WSPAL I + + L   A  SA   DD L N
Sbjct:   36 HVIVTGPNDSPF------EGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQI-RTILLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_MACFA (Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.449e-12
Identity = 42/95 (44.21%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  278 HVPLASHNYGPF**PIC*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            HV +A     PF        G F + +  P +YP   PKV F TK++HPN++ +G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   36 HVVIAGPQDSPF------EGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC22_ARATH (Ubiquitin carrier protein E2 22 OS=Arabidopsis thaliana GN=UBC22 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.421e-12
Identity = 24/58 (41.38%), Postives = 39/58 (67.24%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL 511
            G+F + +    D+P  PPK  F TK+FHPN+ SNG IC++ LK+ W+P+L +  ++ +
Sbjct:   57 GLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASNGEICVNTLKKDWNPSLGLRHVLSV 114          

HSP 2 Score: 30.4166 bits (67), Expect = 5.421e-12
Identity = 16/42 (38.10%), Postives = 20/42 (47.62%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            K++ KELK L + PP         ED     A I GP  +PY
Sbjct:   13 KQLAKELKSLDESPPDGIKVVVNDEDFSQICADIEGPVGTPY 54          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_HUMAN (Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens GN=UBE2C PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.156e-12
Identity = 22/45 (48.89%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            + +++ FP  YP+  P V F T  +HPN+++ G+ICLDILKE+WS
Sbjct:   79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWS 123          

HSP 2 Score: 32.7278 bits (73), Expect = 7.156e-12
Identity = 15/46 (32.61%), Postives = 25/46 (54.35%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            KR+ +EL  L        SA P ++++F W  TI G + + Y D++
Sbjct:   33 KRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLR 78          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC14_ARATH (Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana GN=UBC14 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 7.188e-12
Identity = 23/69 (33.33%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            G F   ++FP +YP  PP V F ++++HPN+ S+G +C+ IL              E+W+P  T+  +V
Sbjct:   53 GFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTVESIV 121          

HSP 2 Score: 38.1206 bits (87), Expect = 7.188e-12
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            AS  + K+LKDL K P    SAG   E ++F W  +IMGP D+ Y
Sbjct:    6 ASLLLQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLY 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC16_SCHPO (Ubiquitin-conjugating enzyme E2 16 OS=Schizosaccharomyces pombe GN=ubc16 PE=2 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 7.218e-12
Identity = 25/53 (47.17%), Postives = 37/53 (69.81%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTI 493
            G +++ I+    YP  PP V F+TK+ HPNI+ +NG +C+DILK  WSPA ++
Sbjct:   52 GQWVLDIHVHEGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSL 104          

HSP 2 Score: 33.113 bits (74), Expect = 7.218e-12
Identity = 11/17 (64.71%), Postives = 15/17 (88.24%), Query Frame = 3
Query:  276 DMFHWQATIMGPSDSPY 326
            DMFHW+A I GP+++PY
Sbjct:   33 DMFHWKAVIEGPTETPY 49          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC19_ARATH (Ubiquitin carrier protein E2 19 OS=Arabidopsis thaliana GN=UBC19 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 9.292e-12
Identity = 25/50 (50.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            + +++ F  DYPFK PKV F T  FHPN++  G+ICLDIL+++WS A  +
Sbjct:   85 YRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDILQDKWSSAYDV 134          

HSP 2 Score: 29.6462 bits (65), Expect = 9.292e-12
Identity = 14/42 (33.33%), Postives = 21/42 (50.00%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            KR+  EL  L        SA P  +++F W+ TI G  D+ +
Sbjct:   39 KRLQSELMGLMMGADPGISAFPEEDNIFCWKGTITGSKDTVF 80          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_XENLA (Ubiquitin-conjugating enzyme E2 C OS=Xenopus laevis GN=ube2c PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 9.292e-12
Identity = 23/45 (51.11%), Postives = 34/45 (75.56%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            + +++ FP  YP+  P V F T  FHPN++S+G+ICLDILK++WS
Sbjct:   79 YKLSLEFPSGYPYNAPTVKFVTPCFHPNVDSHGNICLDILKDKWS 123          

HSP 2 Score: 31.187 bits (69), Expect = 9.292e-12
Identity = 16/51 (31.37%), Postives = 25/51 (49.02%), Query Frame = 3
Query:  186 RVMASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            R    KR+ +EL  L        SA P ++++F W  TI G   + Y D++
Sbjct:   28 RGSVGKRLQQELMTLMMSGDKGISAFPESDNLFKWIGTIDGAVGTVYEDLR 78          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G1_RAT (Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 9.323e-12
Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKE 469
            GVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL E
Sbjct:   53 GVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHE 96          

HSP 2 Score: 31.5722 bits (70), Expect = 9.323e-12
Identity = 14/39 (35.90%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  213 KELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            ++L +L K+P    SAG   + D++ W+  I+GP D+ Y
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLY 50          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBCX_DICDI3.311e-1244.83Ubiquitin-conjugating enzyme E2 pex4 OS=Dictyostel... [more]
UBE2N_DROME3.406e-1245.26Ubiquitin-conjugating enzyme E2 N OS=Drosophila me... [more]
UBE2N_MACFA4.449e-1244.21Ubiquitin-conjugating enzyme E2 N OS=Macaca fascic... [more]
UBC22_ARATH5.421e-1241.38Ubiquitin carrier protein E2 22 OS=Arabidopsis tha... [more]
UBE2C_HUMAN7.156e-1248.89Ubiquitin-conjugating enzyme E2 C OS=Homo sapiens ... [more]
UBC14_ARATH7.188e-1233.33Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis ... [more]
UBC16_SCHPO7.218e-1247.17Ubiquitin-conjugating enzyme E2 16 OS=Schizosaccha... [more]
UBC19_ARATH9.292e-1250.00Ubiquitin carrier protein E2 19 OS=Arabidopsis tha... [more]
UBE2C_XENLA9.292e-1251.11Ubiquitin-conjugating enzyme E2 C OS=Xenopus laevi... [more]
UB2G1_RAT9.323e-1250.00Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norve... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top