EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_CAEEL (Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 6.536e-37
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 75.485 bits (184), Expect = 6.536e-37
Identity = 32/45 (71.11%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL+DL +DPP  CSAGP  +D+FHWQATIMGP +SPY
Sbjct:    1 MALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: U2D2B_RAT (Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.882e-36
Identity = 39/56 (69.64%), Postives = 49/56 (87.50%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I+FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 79.337 bits (194), Expect = 1.882e-36
Identity = 35/45 (77.78%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  EDMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: U2D2B_MOUSE (Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.882e-36
Identity = 39/56 (69.64%), Postives = 49/56 (87.50%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I+FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISK++
Sbjct:   48 GAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVL 103          

HSP 2 Score: 79.337 bits (194), Expect = 1.882e-36
Identity = 35/45 (77.78%), Postives = 37/45 (82.22%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DL +DPP  CSAGP  EDMFHWQATIMGP+DSPY
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPY 45          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC4_CANAL (Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.195e-36
Identity = 41/56 (73.21%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF ++I+FP DYP KPPK+A  TK++HPNINSNG+ICLDILK+QWSPALTISK++
Sbjct:   48 GVFFLSIHFPTDYPLKPPKIALTTKIYHPNINSNGNICLDILKDQWSPALTISKVL 103          

HSP 2 Score: 75.8702 bits (185), Expect = 3.195e-36
Identity = 32/46 (69.57%), Postives = 39/46 (84.78%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            M+ KRI KEL DL +DPP+SCSAGP  +D++HWQA+IMGP DSPYA
Sbjct:    1 MSLKRINKELSDLGRDPPSSCSAGPVGDDLYHWQASIMGPPDSPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC12_ARATH (Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 5.850e-35
Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF V+I+F  DYPFKPPKV F+TKV+HPNI+S GSICLDILKEQWSPA T SK++
Sbjct:   49 GVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVL 104          

HSP 2 Score: 76.2554 bits (186), Expect = 5.850e-35
Identity = 34/47 (72.34%), Postives = 41/47 (87.23%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAA-EDMFHWQATIMGPSDSPYA 329
            MASKRI +EL+D+Q+ PP +CSAGP A ED+FHWQATIMGP DSPY+
Sbjct:    1 MASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYS 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E2_MOUSE (Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.485e-28
Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  102 GVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 157          

HSP 2 Score: 53.9138 bits (128), Expect = 7.485e-28
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 99          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E2_HUMAN (Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.485e-28
Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  102 GVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 157          

HSP 2 Score: 53.9138 bits (128), Expect = 7.485e-28
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 99          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E1_MOUSE (Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.496e-28
Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:   94 GVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 149          

HSP 2 Score: 55.4546 bits (132), Expect = 7.496e-28
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL D+  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   48 SAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 91          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E1_HUMAN (Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 7.496e-28
Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:   94 GVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 149          

HSP 2 Score: 55.4546 bits (132), Expect = 7.496e-28
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL D+  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   48 SAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 91          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBCD2_DROME (Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=UbcD2 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.789e-27
Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  133 GVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 188          

HSP 2 Score: 53.1434 bits (126), Expect = 2.789e-27
Identity = 21/44 (47.73%), Postives = 32/44 (72.73%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W +TI+GP  S Y
Sbjct:   87 SAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVY 130          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBC2_CAEEL6.536e-3776.79Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditi... [more]
U2D2B_RAT1.882e-3669.64Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norv... [more]
U2D2B_MOUSE1.882e-3669.64Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculu... [more]
UBC4_CANAL3.195e-3673.21Ubiquitin-conjugating enzyme E2 4 OS=Candida albic... [more]
UBC12_ARATH5.850e-3575.00Probable ubiquitin-conjugating enzyme E2 12 OS=Ara... [more]
UB2E2_MOUSE7.485e-2871.43Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus... [more]
UB2E2_HUMAN7.485e-2871.43Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens... [more]
UB2E1_MOUSE7.496e-2869.64Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus... [more]
UB2E1_HUMAN7.496e-2869.64Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens... [more]
UBCD2_DROME2.789e-2769.64Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top