EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E3_MOUSE (Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 6.170e-27
Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  108 GVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 163          

HSP 2 Score: 53.9138 bits (128), Expect = 6.170e-27
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 105          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E3_HUMAN (Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.170e-27
Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  108 GVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 163          

HSP 2 Score: 53.9138 bits (128), Expect = 6.170e-27
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 105          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2E3_BOVIN (Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.170e-27
Identity = 39/56 (69.64%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISK++
Sbjct:  108 GVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVL 163          

HSP 2 Score: 53.9138 bits (128), Expect = 6.170e-27
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GP  S Y
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVY 105          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: COP10_ARATH (Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana GN=COP10 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.662e-24
Identity = 28/57 (49.12%), Postives = 47/57 (82.46%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVK 508
            G+F + I FP DYPFKPPK+ F+T+++H N+++ G + ++IL++ WSPALTI+K+++
Sbjct:   83 GIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQ 139          

HSP 2 Score: 58.9214 bits (141), Expect = 2.662e-24
Identity = 23/44 (52.27%), Postives = 33/44 (75.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            + KRI +E+ +L  DPP  CSAGP  ++++HW ATI+GPS +PY
Sbjct:   37 SGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPY 80          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.700e-19
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ ++
Sbjct:   51 GTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVL 106          

HSP 2 Score: 50.0618 bits (118), Expect = 1.700e-19
Identity = 20/44 (45.45%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR++ + K LQKDPP   S  P   ++ HW A I GP D+P+
Sbjct:    5 AKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPW 48          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.876e-19
Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +KVFHPN+ ++G ICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAIL 106          

HSP 2 Score: 49.2914 bits (116), Expect = 2.876e-19
Identity = 19/46 (41.30%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPPT  S  P   ++  W A I GP D+P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_CANAL (Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans GN=UBC2 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.817e-19
Identity = 24/56 (42.86%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F   YP KPP+V F +++FHPN+ ++G +CLDIL+ +WSP   +S ++
Sbjct:   51 GTFRLLLSFDEQYPNKPPQVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 52.373 bits (124), Expect = 4.817e-19
Identity = 19/46 (41.30%), Postives = 33/46 (71.74%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q+DPP+  SA P  +++  W A I+GPSD+P+ D
Sbjct:    5 ARRRLMRDFKRMQQDPPSGVSASPLPDNVMKWNAVIIGPSDTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.320e-19
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 46.9802 bits (110), Expect = 6.320e-19
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2B_RABIT (Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.320e-19
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 46.9802 bits (110), Expect = 6.320e-19
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2B_MOUSE (Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.320e-19
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 46.9802 bits (110), Expect = 6.320e-19
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED 50          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UB2E3_MOUSE6.170e-2769.64Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus... [more]
UB2E3_HUMAN6.170e-2769.64Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens... [more]
UB2E3_BOVIN6.170e-2769.64Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus G... [more]
COP10_ARATH2.662e-2449.12Constitutive photomorphogenesis protein 10 OS=Arab... [more]
UBC3_ARATH1.700e-1950.00Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBCD6_DROME2.876e-1950.00Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC2_CANAL4.817e-1942.86Ubiquitin-conjugating enzyme E2 2 OS=Candida albic... [more]
UBE2B_RAT6.320e-1950.00Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]
UBE2B_RABIT6.320e-1950.00Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus c... [more]
UBE2B_MOUSE6.320e-1950.00Ubiquitin-conjugating enzyme E2 B OS=Mus musculus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top