EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_SCHPO (Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe GN=rhp6 PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 2.355e-18
Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F   YP KPP V F + +FHPN+ +NG +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 51.2174 bits (121), Expect = 2.355e-18
Identity = 18/46 (39.13%), Postives = 33/46 (71.74%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q+DPP   SA P ++++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_TRIHA (Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.062e-18
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP+V F +++FHPN+ +NG +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRLVMQFEEQYPNKPPQVKFISQMFHPNVYANGELCLDILQNRWSPTYDVAAVL 106          

HSP 2 Score: 49.6766 bits (117), Expect = 3.062e-18
Identity = 18/46 (39.13%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q DPP   SA P  +++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQTDPPAGVSASPIPDNVMTWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_YARLI (Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica GN=UBC2 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.062e-18
Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP V F +++FHPN+ S+G +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRMVLQFDEQYPNKPPAVKFVSQMFHPNVYSSGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 50.8322 bits (120), Expect = 3.062e-18
Identity = 18/46 (39.13%), Postives = 33/46 (71.74%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q+DPP   SA P A+++  W A I+GP+++P+ D
Sbjct:    5 ARRRLMRDFKRMQQDPPQGVSASPVADNVLTWNAVIIGPAETPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.976e-18
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ ++
Sbjct:   51 GTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106          

HSP 2 Score: 45.0542 bits (105), Expect = 3.976e-18
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+
Sbjct:    5 ARKRLMRDFKRLQQDPPAGISGAPHDNNITLWNAVIFGPDDTPW 48          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_EMENI (Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans GN=uvsJ PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 6.734e-18
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 51.9878 bits (123), Expect = 6.734e-18
Identity = 19/46 (41.30%), Postives = 32/46 (69.57%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q DPP   SA P A+++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_ASPFU (Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus fumigatus GN=ubc2 PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 6.734e-18
Identity = 23/56 (41.07%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 51.9878 bits (123), Expect = 6.734e-18
Identity = 19/46 (41.30%), Postives = 32/46 (69.57%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q DPP   SA P A+++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_CANGA (Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata GN=UBC2 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.695e-18
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F  DYP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ ++
Sbjct:   51 GTFRLLLEFDEDYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 8.695e-18
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +++D P   SA P  +++  W A I+GP+D+PY D
Sbjct:    5 ARRRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_DEBHA (Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.131e-17
Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP V F +++FHPN+ ++G +CLDIL+ +WSP   +S ++
Sbjct:   51 GTFRLILQFDEQYPNKPPSVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 48.521 bits (114), Expect = 1.131e-17
Identity = 17/46 (36.96%), Postives = 32/46 (69.57%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q+D P+  SA P  +++  W A I+GP+D+P+ D
Sbjct:    5 AKRRLMRDFKRMQQDAPSGVSASPLPDNVMSWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_NEUCR (Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa GN=mus-8 PE=3 SV=3)

HSP 1 Score: 61.2326 bits (147), Expect = 1.139e-17
Identity = 23/56 (41.07%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + ++F   YP KPP V F +++FHPN+ + G +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRLVMHFEEQYPNKPPSVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVL 106          

HSP 2 Score: 50.0618 bits (118), Expect = 1.139e-17
Identity = 18/46 (39.13%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q DPP   SA P  +++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_NECHA (Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.139e-17
Identity = 23/56 (41.07%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP+V F +++FHPN+ + G +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFRLVMQFEEQYPNKPPQVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVL 106          

HSP 2 Score: 50.0618 bits (118), Expect = 1.139e-17
Identity = 18/46 (39.13%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +Q DPP   SA P  +++  W A I+GP+D+P+ D
Sbjct:    5 ARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFED 50          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBC2_SCHPO2.355e-1842.86Ubiquitin-conjugating enzyme E2 2 OS=Schizosacchar... [more]
UBC2_TRIHA3.062e-1842.86Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma h... [more]
UBC2_YARLI3.062e-1842.86Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipo... [more]
UBC2_WHEAT3.976e-1850.00Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC2_EMENI6.734e-1841.07Ubiquitin-conjugating enzyme E2 2 OS=Emericella ni... [more]
UBC2_ASPFU6.734e-1841.07Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus f... [more]
UBC2_CANGA8.695e-1844.64Ubiquitin-conjugating enzyme E2 2 OS=Candida glabr... [more]
UBC2_DEBHA1.131e-1742.86Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces ... [more]
UBC2_NEUCR1.139e-1741.07Ubiquitin-conjugating enzyme E2 2 OS=Neurospora cr... [more]
UBC2_NECHA1.139e-1741.07Ubiquitin-conjugating enzyme E2 2 OS=Nectria haema... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top