EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC7_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC7 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.472e-17
Identity = 26/69 (37.68%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            GVF   + FP DYP  PPK+ F   + HPNI  NG +C+ IL             +E+WSP  ++ K++
Sbjct:   52 GVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKIL 120          

HSP 2 Score: 51.2174 bits (121), Expect = 1.472e-17
Identity = 25/47 (53.19%), Postives = 31/47 (65.96%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPYAD 332
            A KR+LKEL+ L KD P    AGP +E ++F W   I GP D+PYAD
Sbjct:    5 AQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYAD 51          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_YEAST (Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae GN=RAD6 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.483e-17
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ ++
Sbjct:   51 GTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 2.483e-17
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +++D P   SA P  +++  W A I+GP+D+PY D
Sbjct:    5 ARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_ASHGO (Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.483e-17
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ ++
Sbjct:   51 GTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 2.483e-17
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +++D P   SA P  +++  W A I+GP+D+PY D
Sbjct:    5 ARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_KLULA (Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.488e-17
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ ++
Sbjct:   51 GTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 2.488e-17
Identity = 17/46 (36.96%), Postives = 31/46 (67.39%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K +++D P   SA P  +++  W A I+GP+D+PY D
Sbjct:    5 ARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC13_YEAST (Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae GN=UBC13 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.500e-17
Identity = 29/52 (55.77%), Postives = 37/52 (71.15%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G+F + +  P DYP + PKV F TK++HPNI+  G ICLD+LK  WSPAL I
Sbjct:   50 GIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101          

HSP 2 Score: 41.2022 bits (95), Expect = 2.500e-17
Identity = 19/44 (43.18%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            KRI+KE + L  DP    +A P  +++ ++Q TI GP  SPY D
Sbjct:    6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYED 49          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC31_ARATH (Probable ubiquitin carrier protein E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.226e-17
Identity = 32/56 (57.14%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G+F ++I FP DYPFKPPK  F+T ++HPNIN  GSIC++ILK++W+PAL + K++
Sbjct:   54 GMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNILKDKWTPALMVEKVL 109          

HSP 2 Score: 26.1794 bits (56), Expect = 4.226e-17
Identity = 9/24 (37.50%), Postives = 14/24 (58.33%), Query Frame = 3
Query:  255 SAGPAAEDMFHWQATIMGPSDSPY 326
            S G  + +++ W A I GP  +PY
Sbjct:   28 SIGQNSNNIYEWTAVIRGPDGTPY 51          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC36_ARATH (Ubiquitin carrier protein E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.226e-17
Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            GVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I
Sbjct:   52 GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQI 103          

HSP 2 Score: 40.0466 bits (92), Expect = 4.226e-17
Identity = 17/42 (40.48%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            +RI+KE + L  +P    SA P+ E+M ++   I+GP+ SPY
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPY 49          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_SCHPO (Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe GN=ubc1 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 7.022e-17
Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G F+V I  P DYPF+PPK+ F TK++HPN++S  G+ICLDILK+QWSP  T+
Sbjct:   51 GYFVVDIEIPIDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTM 103          

HSP 2 Score: 33.8834 bits (76), Expect = 7.022e-17
Identity = 15/43 (34.88%), Postives = 22/43 (51.16%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            S+RI KEL D+Q+D           +D+ H +    GP  +PY
Sbjct:    6 SRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPY 48          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC35_ARATH (Ubiquitin carrier protein E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 9.289e-17
Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            GVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I
Sbjct:   52 GVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQI 103          

HSP 2 Score: 38.891 bits (89), Expect = 9.289e-17
Identity = 16/42 (38.10%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            +RI+KE + L  +P    SA P+ ++M ++   I+GP+ SPY
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPY 49          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2N_DICDI (Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.041e-16
Identity = 39/75 (52.00%), Postives = 47/75 (62.67%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMVKL*TNARYSA--DDDWLLN 556
            GVF + +    DYP   PKV F TK++HPNI+  G ICLDILK++WSPAL I + V L   A  SA   DD L N
Sbjct:   50 GVFNLELFLTDDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQI-RTVLLSIQALLSAPNPDDPLAN 123          

HSP 2 Score: 38.5058 bits (88), Expect = 2.041e-16
Identity = 17/42 (40.48%), Postives = 26/42 (61.90%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            KRI+KE + L  +P    SA PA ++  +++  I GP DSP+
Sbjct:    6 KRIIKETQRLMTEPAPGISATPATDNFRYFKVAISGPLDSPF 47          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBC7_YEAST1.472e-1737.68Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBC2_YEAST2.483e-1742.86Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces... [more]
UBC2_ASHGO2.483e-1742.86Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossyp... [more]
UBC2_KLULA2.488e-1742.86Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces... [more]
UBC13_YEAST2.500e-1755.77Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyce... [more]
UBC31_ARATH4.226e-1757.14Probable ubiquitin carrier protein E2 31 OS=Arabid... [more]
UBC36_ARATH4.226e-1757.69Ubiquitin carrier protein E2 36 OS=Arabidopsis tha... [more]
UBC1_SCHPO7.022e-1760.38Ubiquitin-conjugating enzyme E2 1 OS=Schizosacchar... [more]
UBC35_ARATH9.289e-1757.69Ubiquitin carrier protein E2 35 OS=Arabidopsis tha... [more]
UBE2N_DICDI2.041e-1652.00Probable ubiquitin-conjugating enzyme E2 N OS=Dict... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top