EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBCB_DICDI (Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 2.662e-16
Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNI-NSNGSICLDILKEQWSPALTI 493
            GVF + I+ P DYPFKPP + F TK++HPNI  S+G+IC ++    WSP L I
Sbjct:   49 GVFSMDIDIPADYPFKPPTLKFTTKIYHPNIKTSDGAICAEVF-STWSPQLKI 100          

HSP 2 Score: 45.8246 bits (107), Expect = 2.662e-16
Identity = 19/44 (43.18%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR+ KE+ D+ K PP+ CSA    +++  W+AT+ GP  SP+
Sbjct:    3 AHKRLQKEITDMLKTPPSWCSAHLVDDNLQKWKATVQGPEGSPF 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_YEAST (Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae GN=UBC1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.389e-16
Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTI 493
            G F+V I  P +YPFKPPK+ F TKV+HPNI+S  G+ICLDILK  WSP +T+
Sbjct:   50 GKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITL 102          

HSP 2 Score: 32.7278 bits (73), Expect = 3.389e-16
Identity = 15/44 (34.09%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            +KRI+KE++ ++ DP    +    +E D+ H + T +GP  +PY
Sbjct:    4 AKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPY 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 5.838e-16
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            F +++ F  +YP   P V F +K+FHPN+ ++GSICLDIL+ QWSP   I+ ++
Sbjct:   53 FKLSLQFSEEYPNDAPTVKFLSKMFHPNVYADGSICLDILQNQWSPIYDIAAIL 106          

HSP 2 Score: 45.0542 bits (105), Expect = 5.838e-16
Identity = 18/42 (42.86%), Postives = 25/42 (59.52%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDS 320
            A +R++++ K LQ DPP   S  P   ++  WQA I GP DS
Sbjct:    5 ARRRLMRDFKRLQSDPPAGISGAPLENNILMWQAVIFGPDDS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC14_SCHPO (Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe GN=ubc14 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 9.836e-16
Identity = 24/58 (41.38%), Postives = 42/58 (72.41%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ-WSPALTISKMVK 508
            G F  ++ FP DYPF+PP + F T+++HPN +S G++CL ILK+Q + P++ +  +++
Sbjct:   54 GKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLE 111          

HSP 2 Score: 43.1282 bits (100), Expect = 9.836e-16
Identity = 18/45 (40.00%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            +S+R+ KE  DL++ P          +++FHW  T +GPSDS YA
Sbjct:    8 SSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYA 52          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_CRYNE (Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus neoformans GN=UBC2 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.654e-15
Identity = 26/56 (46.43%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP V F +K+FHPNI +NG +CLDIL+ +WSP   ++ ++
Sbjct:   51 GSFRLTLTFTDAYPNKPPTVRFISKMFHPNIYANGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 40.4318 bits (93), Expect = 1.654e-15
Identity = 15/46 (32.61%), Postives = 26/46 (56.52%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K L  D P   S  P  +++  W A I GP ++P+ D
Sbjct:    5 AKRRLIRDFKRLTSDAPIGISGSPNPDNIMVWNAVIFGPPETPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC13_SCHPO (Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe GN=ubc13 PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 6.194e-15
Identity = 26/52 (50.00%), Postives = 34/52 (65.38%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            G F + +  P +YP  PP V F TK++HPN++  G ICL  LK+ WSPAL I
Sbjct:   49 GKFHLELFLPDEYPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQI 100          

HSP 2 Score: 39.6614 bits (91), Expect = 6.194e-15
Identity = 16/42 (38.10%), Postives = 27/42 (64.29%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            KRI+KE++ L +DPP    A P  +++ +++ T+ GP  S Y
Sbjct:    5 KRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAY 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_SPISO (Ubiquitin-conjugating enzyme E2 C OS=Spisula solidissima GN=UBE2C PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.342e-14
Identity = 24/50 (48.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTI 493
            + + + FP DYP+KPP V F T  +HPN++ +G+ICLDILKE W+ +  +
Sbjct:   79 YKLTLEFPSDYPYKPPVVKFTTPCWHPNVDQSGNICLDILKENWTASYDV 128          

HSP 2 Score: 36.5798 bits (83), Expect = 1.342e-14
Identity = 17/51 (33.33%), Postives = 28/51 (54.90%), Query Frame = 3
Query:  186 RVMASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            R   SKR+ +EL+ L        +A P  +++F W AT+ GP D+ Y  ++
Sbjct:   28 RHSVSKRLQQELRTLLMSGDPGITAFPDGDNLFKWVATLDGPKDTVYESLK 78          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC21_ARATH (Probable ubiquitin carrier protein E2 21 OS=Arabidopsis thaliana GN=UBC21 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.353e-14
Identity = 30/58 (51.72%), Postives = 40/58 (68.97%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKMVK 508
            GVF +A + P  YP +PP+V F TK+FHPN++   G ICLDILK  WSPA T+  + +
Sbjct:   52 GVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCR 109          

HSP 2 Score: 31.9574 bits (71), Expect = 1.353e-14
Identity = 15/43 (34.88%), Postives = 24/43 (55.81%), Query Frame = 3
Query:  204 RILKELKDLQKDPPTSCSAGPAAED--MFHWQATIMGPSDSPY 326
            R+ KE K++Q++           +D  +F W A I GPS++PY
Sbjct:    7 RLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPY 49          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G2_PONAB (Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.958e-14
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 2
Query:  326 C*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            C   GVF   ++FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K++
Sbjct:   48 CFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL 120          

HSP 2 Score: 41.5874 bits (96), Expect = 2.958e-14
Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPA-AEDMFHWQATIMGPSDS 320
            A KR++ E K L  +PP    AGP   E+ F W+A IMGP D+
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDT 47          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2G2_MOUSE (Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.958e-14
Identity = 27/73 (36.99%), Postives = 40/73 (54.79%), Query Frame = 2
Query:  326 C*YAGVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            C   GVF   ++FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K++
Sbjct:   48 CFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL 120          

HSP 2 Score: 41.5874 bits (96), Expect = 2.958e-14
Identity = 20/43 (46.51%), Postives = 26/43 (60.47%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPA-AEDMFHWQATIMGPSDS 320
            A KR++ E K L  +PP    AGP   E+ F W+A IMGP D+
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDT 47          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBCB_DICDI2.662e-1652.83Ubiquitin conjugating enzyme E2 B OS=Dictyostelium... [more]
UBC1_YEAST3.389e-1662.26Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharo... [more]
UBC2_DICDI5.838e-1646.30Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
UBC14_SCHPO9.836e-1641.38Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccha... [more]
UBC2_CRYNE1.654e-1546.43Ubiquitin-conjugating enzyme E2 2 OS=Cryptococcus ... [more]
UBC13_SCHPO6.194e-1550.00Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccha... [more]
UBE2C_SPISO1.342e-1448.00Ubiquitin-conjugating enzyme E2 C OS=Spisula solid... [more]
UBC21_ARATH1.353e-1451.72Probable ubiquitin carrier protein E2 21 OS=Arabid... [more]
UB2G2_PONAB2.958e-1436.99Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii... [more]
UB2G2_MOUSE2.958e-1436.99Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top