EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_ECOLI (Glycerol uptake facilitator protein OS=Escherichia coli (strain K12) GN=glpF PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.867e-13
Identity = 61/192 (31.77%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTL-----RLLFQEKQD-----------QFA*TLXAGSN-----IQAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            +AE LGT  +IF G   V              IS++WGL V + +Y    +SGAH NP+VTIA      F  ++V P+I+ QV G+  AA  +      L F  +Q              A T     N     +QAF +E +IT  LM +I  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   12 IAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMN 203          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_ECOL6 (Glycerol uptake facilitator protein OS=Escherichia coli O6 GN=glpF PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.867e-13
Identity = 61/192 (31.77%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTL-----RLLFQEKQD-----------QFA*TLXAGSN-----IQAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            +AE LGT  +IF G   V              IS++WGL V + +Y    +SGAH NP+VTIA      F  ++V P+I+ QV G+  AA  +      L F  +Q              A T     N     +QAF +E +IT  LM +I  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   12 IAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMN 203          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: GLPF_ECO57 (Glycerol uptake facilitator protein OS=Escherichia coli O157:H7 GN=glpF PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.867e-13
Identity = 61/192 (31.77%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTL-----RLLFQEKQD-----------QFA*TLXAGSN-----IQAFVMEFIITFYLMFVISGVATDNRAI--GELAGLAVGFTVLANVMFARPITGASMN 738
            +AE LGT  +IF G   V              IS++WGL V + +Y    +SGAH NP+VTIA      F  ++V P+I+ QV G+  AA  +      L F  +Q              A T     N     +QAF +E +IT  LM +I  +  D   +  G LA L +G  +        P+TG +MN
Sbjct:   12 IAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMN 203          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP41_MAIZE (Aquaporin TIP4-1 OS=Zea mays GN=TIP4-1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.662e-13
Identity = 58/207 (28.02%), Postives = 94/207 (45.41%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEK------IVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD-KGLWIYMVAHLYG 816
            ++ ++AE++ T+  +F G ++ +   ++ K      + +L  ++I   L   VLV +  H+SG H NP+VT+           +   Y+  Q+L S+ A   LR L               S +Q  VME I+TF L+FV   +  D R+ +  +  L  G  V AN +     TGASMN   S     +  D    W+Y +  L G
Sbjct:   23 VRAVLAELVLTFLFVFTGVSAAMAAGSDGKPGDAMPMATLAAVAIAHALAAGVLVTAGFHVSGGHLNPAVTVGLMVRGHITKLRAVLYVAAQLLASSAACVLLRFLSGGMVTPVHALGRGISPMQGLVMEVILTFSLLFVTYAMILDPRSQVRAIGPLLTGLIVGANSLAGGNFTGASMNPARSFGPALATGDWTNHWVYWIGPLLG 229          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_RABIT (Lens fiber major intrinsic protein OS=Oryctolagus cuniculus GN=MIP PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.229e-12
Identity = 65/216 (30.09%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   Y+  Q+LG+   A  L  +     + +    TL  G ++ QA  +E  +T  L FV+   AT D R  G L    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGA--------SLRWAPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAICYMAAQLLGAVAGAAVLYSVTPAAVRGNLALNTLHPGVSLGQATTVEIFLT--LQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_CANFA (Lens fiber major intrinsic protein OS=Canis familiaris GN=MIP PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.229e-12
Identity = 65/216 (30.09%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   Y+  Q+LG+   A  L  +     + +    TL  G ++ QA  +E  +T  L FV+   AT D R  G L    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGA--------SLRWTPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATTVEIFLT--LQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_BOVIN (Lens fiber major intrinsic protein OS=Bos taurus GN=MIP PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.229e-12
Identity = 64/216 (29.63%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   + F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT A     +    +   Y++ Q+LG+   A  L  +     + +    TL  G ++ QA ++E  +T  L FV+   AT D R  G L    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAICAEFFASLFYVFFGLGA--------SLRWAPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAICYMVAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATIVEIFLT--LQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPVIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP7_RAT (Aquaporin-7 OS=Rattus norvegicus GN=Aqp7 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.229e-12
Identity = 39/110 (35.45%), Postives = 63/110 (57.27%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA 546
            ++++ +AE L TY ++  G  SV   +  E++ S  G+++ +G  V + ++  G ISGAH N +VT  +    R  WK+ P Y+L Q LGS LAA T  L+F    + +A
Sbjct:   17 WVREFLAEFLSTYVLMVFGLGSVAHMVLGERLGSYLGVNLGFGFGVTMGIHVAGGISGAHMNAAVTFTNCALGRMAWKKFPIYVLGQFLGSFLAAATTYLIFYGAINHYA 126          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP42_MAIZE (Aquaporin TIP4-2 OS=Zea mays GN=TIP4-2 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.912e-12
Identity = 63/212 (29.72%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGC-ASVVVNLNNEK-----IVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN-IQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            ++ ++AE++ T+  +F G  AS+      +      + +L  ++I   L   VLV +  H+SG H NP+VT+           +   Y+  Q+L S+LA   LR L           L AG   +Q  VME I+TF L+FV   +  D R+ +  +  L  G  V AN +     TGASMN   S G +  +      W+Y +  L G   A
Sbjct:   25 VRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMPMATLAAVAIAHALAAGVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACILLRYLSGGMVTPVH-ALGAGIRPMQGLVMEVILTFSLLFVTYAMILDPRSQVRTIGPLLTGLIVGANSLAGGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLA 235          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_CAVPO (Lens fiber major intrinsic protein OS=Cavia porcellus GN=MIP PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.912e-12
Identity = 65/216 (30.09%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  +         +   PG      +++ +GL +  LV ++GHISGAH NP+VT       +    +   Y+  Q+LG+   A  L  +     + +    TL AG ++ QA  +E  +T  L FV+   AT D R  G L    LAVGF++    +F    TGA MN   S A +  +++    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGA--------SLRWAPGPLHVLQVALAFGLALAXLVQTVGHISGAHVNPAVTFXFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVXQATTVEIFLT--LQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIG 211          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
GLPF_ECOLI5.867e-1331.77Glycerol uptake facilitator protein OS=Escherichia... [more]
GLPF_ECOL65.867e-1331.77Glycerol uptake facilitator protein OS=Escherichia... [more]
GLPF_ECO575.867e-1331.77Glycerol uptake facilitator protein OS=Escherichia... [more]
TIP41_MAIZE7.662e-1328.02Aquaporin TIP4-1 OS=Zea mays GN=TIP4-1 PE=2 SV=1[more]
MIP_RABIT2.229e-1230.09Lens fiber major intrinsic protein OS=Oryctolagus ... [more]
MIP_CANFA2.229e-1230.09Lens fiber major intrinsic protein OS=Canis famili... [more]
MIP_BOVIN2.229e-1229.63Lens fiber major intrinsic protein OS=Bos taurus G... [more]
AQP7_RAT2.229e-1235.45Aquaporin-7 OS=Rattus norvegicus GN=Aqp7 PE=2 SV=2[more]
TIP42_MAIZE2.912e-1229.72Aquaporin TIP4-2 OS=Zea mays GN=TIP4-2 PE=2 SV=1[more]
MIP_CAVPO2.912e-1230.09Lens fiber major intrinsic protein OS=Cavia porcel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top