EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP_CICVR (Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.912e-12
Identity = 57/210 (27.14%), Postives = 95/210 (45.24%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVV-VNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNI------QAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYGDCXA 828
            L AE++GT  ++  G  S   V ++   +V    I++ +G ++  +V  +GH+SG H NP+VT            +   YI+ Q +G+   +  L+++      +F  TL   S          F++E  ITF L+ ++  V  D R  +G  A +AVG  +    + A   TG+SMN   S   A N   +    W+Y    + G   A
Sbjct:   29 LAAELIGTLLLVLIGTGSCTGVQISEGDVVVR--IALTFGFIIATMVQCIGHVSGCHINPAVTCGLLVTGHISILKAIFYIIVQCVGAIAGSAILKVI---TPAEFRGTLCMTSLAPGVTPPMGFLVEACITFVLILLVQSVCDDRRKNLGNAAPVAVGLAITCCHLAAIKYTGSSMNPARSFGPAVNGDDNWANHWVYWAGPIVGGVVA 233          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP73_HUMAN (Putative aquaporin-7-like protein 3 OS=Homo sapiens GN=AQP7P3 PE=5 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.912e-12
Identity = 38/100 (38.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF 522
            ++ +AE + TY M+  G  SV   L N+   S  G+++ +G  V + V+  G  SGAH N +V++ +    R PW++ P Y+L Q LGS LAA T+  LF
Sbjct:   35 REFLAEFMSTYVMMVFGLGSVAHMLLNKTFGSYLGVNLGFGFGVTMGVHMAGRTSGAHMNAAVSLTNCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLF 134          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP2_RAT (Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.912e-12
Identity = 61/210 (29.05%), Postives = 99/210 (47.14%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLL--FQEKQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGELA--GLAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYG 816
            S+ F + ++AE L T   +F G  S +   ++    S+  I++ +GL + +LV +LGH+SGAH NP+VT+A        + +   Y+  Q+LG+   A  L  +   + + D     L   +   QA  +E  +T  L+  I   +TD R    L    L++GF+V    +     TG SMN   S   A    K D   W++ +  L G
Sbjct:    6 SIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP--SVLQIAVAFGLGIGILVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIF-ASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDH-WVFWIGPLVG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP2_SHEEP (Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.803e-12
Identity = 64/211 (30.33%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLN-NEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGELA--GLAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYG 816
            S+ F + ++AE L T   +F G  S    LN  + + S+  I++ +GL +  LV +LGH+SGAH NP+VT+A        + +   Y+  Q+LG+   A  L  +     + D     L   S   QA  +E  +T  L+  I   +TD R   +L    L++GF+V    +     TG SMN   S   A    K D   W++ +  L G
Sbjct:    6 SIAFSRAVLAEFLATLLFVFFGLGSA---LNWPQALPSVLQIAMAFGLAIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAVFYVAAQLLGAVAGAALLHEITPPAIRGDLAVNALNNNSTAGQAVTVELFLTLQLVLCIF-PSTDKRRGKQLGHPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAIVTGKFDDH-WVFWIGPLVG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP2_MOUSE (Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.803e-12
Identity = 61/210 (29.05%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLL--FQEKQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGELA--GLAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYG 816
            S+ F + ++AE L T   +F G  S +   ++    S+  I++ +GL +  LV +LGH+SGAH NP+VT+A        + +   Y+  Q+LG+   A  L  +   + + D     L   +   QA  +E  +T  L+  I   +TD R    L    L++GF+V    +     TG SMN   S   A    K D   W++ +  L G
Sbjct:    6 SIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP--SVLQIAVAFGLGIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQAVTVELFLTMQLVLCIF-ASTDERRSDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDH-WVFWIGPLVG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP2_BOVIN (Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.803e-12
Identity = 65/212 (30.66%), Postives = 100/212 (47.17%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLN-NEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGELAG---LAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYG 816
            S+ F + ++AE L T   +F G  S    LN  + + S+  I++ +GL +  LV +LGH+SGAH NP+VT+A        + +   Y+  Q+LG+   A  L  +     + D     L   S   QA  +E  +T  L+  I   +TD R  G+  G   L++GF+V    +     TG SMN   S   A    K D   W++ +  L G
Sbjct:    6 SIAFSRAVLAEFLATLLFVFFGLGSA---LNWPQALPSVLQIAMAFGLAIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAVFYVAAQLLGAVAGAALLHEITPPAIRGDLAVNALNNNSTAGQAVTVELFLTLQLVLCIF-ASTDERR-GDNVGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAIVTGKFDDH-WVFWIGPLVG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: MIP_HUMAN (Lens fiber major intrinsic protein OS=Homo sapiens GN=MIP PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.966e-12
Identity = 66/216 (30.56%), Postives = 99/216 (45.83%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVAT-DNRAIGEL--AGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            S  F + + AE   T F +F G  S         +   PG      +++ +GL +  LV S+GHISGAH NP+VT A     +    +   Y+  Q+LG+   A  L  +     + +    TL    ++ QA  +E  +T  L FV+   AT D R  G+L    LAVGF++    +F    TGA MN   S A +  + +    W+Y V  + G
Sbjct:    6 SASFWRAIFAEFFATLFYVFFGLGS--------SLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLT--LQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIG 211          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PIP28_ARATH (Probable aquaporin PIP2-8 OS=Arabidopsis thaliana GN=PIP2-8 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.486e-12
Identity = 62/223 (27.80%), Postives = 97/223 (43.50%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKI---VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF---A*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNRA-----IGELAGLAVGFTVLANVMFARPITGASMNXQES-GAS---NCSKSDKGLWIYMVAHLYGDCXAVGY 837
            F + ++AE + T   ++   A+V+ + N       V L GI+  +G ++ VLVY    ISG H NP+VT      ++    +   Y++ Q LG+    G ++        +    A T+  G S   A   E I TF L++ +       R+     +  LA L +GF V    +   PITG  +N   S GA+   N  K+    WI+ V    G   A  Y
Sbjct:   34 FYRAIIAEFIATLLFLYVTVATVIGHKNQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAY 256          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PIP27_ARATH (Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7 PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.486e-12
Identity = 63/227 (27.75%), Postives = 97/227 (42.73%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKI---VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNI--------QAFVMEFIITFYLMFVISGVATDNRA-----IGELAGLAVGFTVLANVMFARPITGASMNXQES-GAS---NCSKSDKGLWIYMVAHLYGDCXAVGY 837
            F + L+AE + T   ++   A+V+ +         V L GI+  +G ++ VLVY    ISG H NP+VT      ++    +   Y++ Q LG+    G ++   +   +    TL  G+N          A   E I TF L++ +       R+     I  LA L +GF V    +   PITG  +N   S GA+   N  K+    WI+ V    G   A  Y
Sbjct:   36 FYRALIAEFIATLLFLYVTVATVIGHKKQTGPCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYN----TLGGGANTVADGYSKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAY 258          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PIP27_ORYSJ (Probable aquaporin PIP2-7 OS=Oryza sativa subsp. japonica GN=PIP2-7 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 8.471e-12
Identity = 61/222 (27.48%), Postives = 96/222 (43.24%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVVVNLNNEKIVSLP------GISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF---A*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNRA-----IGELAGLAVGFTVLANVMFARPITGASMNXQES-GAS---NCSKSDKGLWIYMVAHLYGDCXAVGY 837
            L+AE + T   ++   A+V+   N    V         G++  +G  + VLVY  G +SG H NP+VT+     ++    +   Y++ Q LG+   AG ++ + +   D     A T+  G S   A   E + TF L++ +       R      I  L  L +GF V    +   PITG  +N   S GA+   N   + K  WI+ V  + G   A  Y
Sbjct:   46 LIAEFMATLIFLYVSIATVIGYKNQRATVDACTGVGYLGVAWSFGATIFVLVYCTGGVSGGHINPAVTLGLFFGRKLSLVRTVLYVVAQCLGAIAGAGIVKGIMKRPYDALGGGANTVSDGYSAAGALGAEIVGTFILVYTVFSATDPKRTARDSFIPVLVPLPIGFAVFVVHLATIPITGTGINPARSLGAAVLYNQHAAWKDHWIFWVGPVIGAFLAAAY 267          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQP_CICVR2.912e-1227.14Aquaporin AQPcic OS=Cicadella viridis GN=AQP PE=1 ... [more]
AQP73_HUMAN2.912e-1238.00Putative aquaporin-7-like protein 3 OS=Homo sapien... [more]
AQP2_RAT2.912e-1229.05Aquaporin-2 OS=Rattus norvegicus GN=Aqp2 PE=1 SV=1[more]
AQP2_SHEEP3.803e-1230.33Aquaporin-2 OS=Ovis aries GN=AQP2 PE=2 SV=1[more]
AQP2_MOUSE3.803e-1229.05Aquaporin-2 OS=Mus musculus GN=Aqp2 PE=2 SV=2[more]
AQP2_BOVIN3.803e-1230.66Aquaporin-2 OS=Bos taurus GN=AQP2 PE=2 SV=2[more]
MIP_HUMAN4.966e-1230.56Lens fiber major intrinsic protein OS=Homo sapiens... [more]
PIP28_ARATH6.486e-1227.80Probable aquaporin PIP2-8 OS=Arabidopsis thaliana ... [more]
PIP27_ARATH6.486e-1227.75Aquaporin PIP2-7 OS=Arabidopsis thaliana GN=PIP2-7... [more]
PIP27_ORYSJ8.471e-1227.48Probable aquaporin PIP2-7 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top