EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP51_MAIZE (Aquaporin TIP5-1 OS=Zea mays GN=TIP5-1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.491e-11
Identity = 63/228 (27.63%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVN--LNNEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVI-----------SGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            FS P ++  +AE + T+  +F    S +    L    + S  G      ++  +GL   VL+ +   +SG H NP+VT A+A   R        Y   Q+LG+T A  +L L    ++        A +     V+E ++TF L++ +            G      A   L  LAVG T  A V+ A  +TGASMN   S G +  S   K   +Y    + G   A
Sbjct:   14 FSAPSLRSYLAEFISTFLFVFTAVGSAISARMLTTPDVTSSAGPLVATAVAQAFGLFAAVLIAA--DVSGGHVNPAVTFAYAIGGRIGVPSAMFYWASQLLGATFACLSLNLFSAGEEVPTTRIAVAMTGFGGAVLEGVLTFLLVYTVHVVGEREPRSRGGDGKREFAATALGALAVGLTQGAFVLAAGALTGASMNPARSFGPAVVSGHFKNQAVYWAGPMVGAAVA 239          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: PIP1_ATRCA (Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.491e-11
Identity = 58/223 (26.01%), Postives = 95/223 (42.60%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVV-VNLNNEKIVSLPGISIVW--GLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF---A*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGE-----LAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSDKGL----WIYMVAHLYGDCXAVGY 837
            F +  +AE + T   ++   A+V+      +   S+  + I W  G ++ VLVY    ISG H NP+VT      ++    +   Y++ Q  G+    G ++   +   +QF   A ++  G N   AF  E I TF L++ +       R+  +     LA L +GF V    +   PITG  +N   S  +    + K +    WI+ V    G   A  Y
Sbjct:   38 FWRAAIAEFIATLLFLYITVATVIGYKKETDPCASVGLLGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFGAELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAY 260          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP5_PIG (Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.171e-11
Identity = 57/214 (26.64%), Postives = 98/214 (45.79%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNI---QAFVMEFIITFYLMFVISGVATDNRAIGELA--GLAVGFTVLANVMFARPITGASMNXQES--GASNCSKSDKGLWIYMVAHLYGDCXA 828
            S+ F++ + AE L T   +F G AS +   +   + ++  I++ +GL +  L  +LG +SG H NP++T+A     +    +   Y++ Q++G+   AG L  L               +N    QA V+E I+TF L   I   +TD+R    +    L++G +V    +     TG SMN   S   A   ++     W++ V  + G   A
Sbjct:    7 SLAFLKAVFAEFLATLIFVFFGLASALKWPS--ALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLALLVGNQISLLRAVFYVVAQLVGAIAGAGILYGLAPGNARGNLAVNSLNNNTTPGQAVVVEMILTFQLALCIFS-STDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAAVA 217          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP1_BOVIN (Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 7.171e-11
Identity = 63/219 (28.77%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVV-------VNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF--A*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNRAIGELAG---LAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAV 831
            F + ++AE L     IF    S +        N     +     +S+ +GL +  L  S+GHISGAH NP+VT+      +    +   YI+ Q +G+ +A   L  +     D       L  G N  Q   +E I T  L  V+  +AT +R   +L G   LA+GF+V    + A   TG  +N   S G+S  + + +  WI+ V    G   AV
Sbjct:   10 FWRAVVAEFLAMILFIFISIGSALGFHYPIKSNQTTGAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISVLRAIMYIIAQCVGAIVATAILSGITSSLPDNSLGLNALAPGVNSGQGLGIEIIGT--LQLVLCVLATTDRRRRDLGGSGPLAIGFSVALGHLLAIDYTGCGINPARSFGSSVITHNFQDHWIFWVGPFIGAALAV 226          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.366e-11
Identity = 61/208 (29.33%), Postives = 97/208 (46.63%), Query Frame = 1
Query:  232 MAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGI---SIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN-IQAFVMEFIITFYLMFVISGVATDNRA--IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            +AE + T   +FAG  S +    L +    +  G+   S+   L + V V    +ISG H NP+VT            +   Y + Q+LGS +A   L++         A +L AG   + A V+E ++TF L++ +   A D +   +G +A +A+GF V AN++      GASMN   S G +  +   +  W+Y V  L G   A
Sbjct:   24 VAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAA-LGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIA 230          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP9_MOUSE (Aquaporin-9 OS=Mus musculus GN=Aqp9 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.366e-11
Identity = 51/194 (26.29%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVV-VNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA--*TLXAGSNIQAFVM----------------EFIITFYLMFVISGVATDNRAIGELAGL---AVGFTVLANVMFARPITGASMN 738
            ++ ++E LGT+ MI  GC S+    L+ EK   +  I+I +   V++ +Y+   +SG H NP+V+ A  T  R  W + P Y+  Q+LG+ + A T+  ++ +    FA    L  G N  AF+                 + + T +L+ ++  +  D+R +G   GL    +G  ++         +G +MN
Sbjct:   24 KETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATVFGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAI-FDSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMN 216          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP3_RAT (Aquaporin-3 OS=Rattus norvegicus GN=Aqp3 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.366e-11
Identity = 39/110 (35.45%), Postives = 59/110 (53.64%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVV-VNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA 546
            +++ +AE LGT  ++  GC SV  V L+         I++ +G  V + +   G +SGAH NP+VT A     R PW ++P Y L Q LG+ L AG +  L+ +    FA
Sbjct:   22 LRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWAFA 131          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
TIP51_MAIZE5.491e-1127.63Aquaporin TIP5-1 OS=Zea mays GN=TIP5-1 PE=2 SV=1[more]
PIP1_ATRCA5.491e-1126.01Aquaporin PIP-type OS=Atriplex canescens PE=2 SV=1[more]
AQP5_PIG7.171e-1126.64Aquaporin-5 OS=Sus scrofa GN=AQP5 PE=2 SV=1[more]
AQP1_BOVIN7.171e-1128.77Aquaporin-1 OS=Bos taurus GN=AQP1 PE=1 SV=3[more]
TIP12_MAIZE9.366e-1129.33Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
AQP9_MOUSE9.366e-1126.29Aquaporin-9 OS=Mus musculus GN=Aqp9 PE=2 SV=1[more]
AQP3_RAT9.366e-1135.45Aquaporin-3 OS=Rattus norvegicus GN=Aqp3 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top