EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_CHRVO (Aquaporin Z OS=Chromobacterium violaceum GN=aqpZ PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.481e-21
Identity = 67/215 (31.16%), Postives = 108/215 (50.23%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNC---SKSDKGLWIYMVAHLYG 816
            M+   AE LGT++++  GC S V+      + +   G+++ +GL V+ + Y++GHISG H NP+V+I      RFP  Q+ PYI+ QVLG+ +AAG +  +       F       SN            + A V E ++T + + VI G ATD RA    A LA+G  +    + + P+T  S+N   S          + + LW++ +A + G
Sbjct:    1 MKSYGAEFLGTFWLVLGGCGSAVLAAGFPNLGIGFAGVALAFGLTVVTMAYAIGHISGCHLNPAVSIGLWAGGRFPAGQLAPYIVAQVLGA-IAAGAVLYVIASGGAGFDVAKGFASNGYAEHSPGGYSLLAALVCEVVMTMFFLLVIMG-ATDKRAPAGFAPLAIGLALTLIHLISIPVTNTSVNPARSTGVALFVGGWAVQQLWLFWLAPIIG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPM_ARCFU (Probable aquaporin aqpM OS=Archaeoglobus fulgidus GN=aqpM PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.644e-21
Identity = 81/236 (34.32%), Postives = 114/236 (48.31%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLN-----------NEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXA-GSNI--------QAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSDKG--LWIYMVAHLYGD-CXAVGYKW 843
            ++  AE++GT+ ++F G  + V+ L            N  I +L G      I + + L +  ++YSLG ISGAH NP+VTIA  +  RFP ++V PYI+ Q +G+ L +    LLF       A T+   G+          QA + E I TF LM VI GVA D RA    AGL +G TV   +     ITG+S+N   +       S  G  LW Y   ++ G    AV   W
Sbjct:    7 KRFTAEVVGTFILVFFGPGAAVITLMIANGADKPNEFNIGIGALGGLGDWFAIGMAFALAIAAVIYSLGRISGAHINPAVTIALWSIGRFPGREVVPYIVAQFIGAALGS----LLFLACVGPAAATVGGLGATAPFPGIGYGQAILTEAIGTFLLMLVIMGVAVDERAPPGFAGLVIGLTVGGIITTIGNITGSSLNPARTFGPYLGDSLMGINLWQYFPIYVIGPIVGAVAAAW 238          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_PSEAE (Aquaporin Z OS=Pseudomonas aeruginosa GN=aqpZ PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.984e-21
Identity = 66/214 (30.84%), Postives = 109/214 (50.93%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEK----------QDQFA*TLXAGSNIQ-AFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            M++  AE  GT++++  GC S V+     ++ +   G+++ +GL V+ + Y++G ISGAH NP+V++      RFP  Q+ PY++ QVLG   A G L L+   K           + +      G ++Q A V E ++T   + +I G AT  RA    A +A+G T+    + + P+T  S+N   S A      D     LW++ VA + G
Sbjct:    1 MKQYGAEFFGTFWLVLGGCGSAVLAAGVPELGIGYLGVALAFGLSVLTMAYAIGPISGAHLNPAVSVGLWVGGRFPASQLLPYVVAQVLGGLAAGGVLYLIASGKAGFDLAAGFASNGYGEHSPGGYSLQAALVSEVVLTGMFLLIILG-ATSKRAPQGFAPIAIGLTLTLIHLISIPVTNTSVNPARSTAVALYVGDWAVSQLWLFWVAPILG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ2_RHIME (Aquaporin Z 2 OS=Rhizobium meliloti GN=aqpZ2 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.703e-20
Identity = 66/221 (29.86%), Postives = 108/221 (48.87%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGDCXAVGYKW 843
            +KL AE LGT +++  GC S V+     ++ + L G+S  +GL V+ + Y++G ISG HFNP+V++  A   R P   +  Y++ QV G+ +AA  L ++   K D    +  A           S   A V E ++TF+ + +I G +T  R     A +A+G  +    + + P+T  S+N   S              LW++ +A L+G   A G  W
Sbjct:    3 KKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFGLTVLTMAYTVGGISGGHFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVIATGKADFQLGSFAANGYGEHSPGGYSLTAALVTEVVMTFFFLIIILG-STHRRVPAGFAPIAIGLALTLIHLVSIPVTNTSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIA-GIVW 221          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ2_AGRT5 (Aquaporin Z 2 OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=aqpZ2 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.905e-20
Identity = 60/212 (28.30%), Postives = 108/212 (50.94%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEK---------QDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +KL+AE  GT++++F GC S V      ++ +   G+++ +GL V+ + Y++G ISG HFNP+V++      RFP   + PY++ QV G+ +AA  L ++   K          + +      G S + A ++E I+T + + VI G +T  R     A +A+G  +    + + P+T  S+N   S            + LW++ +A + G
Sbjct:    3 RKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILG-STHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUAB (Aquaporin Z OS=Brucella abortus GN=aqpZ PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.955e-20
Identity = 64/215 (29.77%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESG-----ASNCSKSDKGLWIYMVAHLYG 816
            + KL AE  GT++++F GC S ++     ++ +   G+++ +GL V+ + Y++G ISG HFNP+V++      R P K + PY + QVLG+  AA  L ++   K    A  L +           S +   ++E I+T + + +I G +T + A    A +A+GF +    + + P+T  S+N   S      A   + S   LW++ VA L G
Sbjct:    2 LNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILG-STSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADRAALSQ--LWLFWVAPLVG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUA2 (Aquaporin Z OS=Brucella abortus (strain 2308) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.955e-20
Identity = 64/215 (29.77%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESG-----ASNCSKSDKGLWIYMVAHLYG 816
            + KL AE  GT++++F GC S ++     ++ +   G+++ +GL V+ + Y++G ISG HFNP+V++      R P K + PY + QVLG+  AA  L ++   K    A  L +           S +   ++E I+T + + +I G +T + A    A +A+GF +    + + P+T  S+N   S      A   + S   LW++ VA L G
Sbjct:    2 LNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILG-STSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADRAALSQ--LWLFWVAPLVG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP41_ORYSJ (Aquaporin NIP4-1 OS=Oryza sativa subsp. japonica GN=NIP4-1 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.452e-20
Identity = 64/204 (31.37%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFP-WKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQF---A*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++++M E L ++ ++F  C + ++       ++ P + +V   V M + + L  +  AHFNP+VTI  A  +RFP W ++P Y+  Q+ GS LA  ++  + + + D F   A  +  G+ +  F+MEF+ +  LM VI+ VATD  A   + G+A+G  V    +   P++G SMN   + G +       G+WIY+VA + G
Sbjct:   56 IREVMVEGLASFLVVFWSCVAALMQ-EMYGTLTFPMVCLV---VAMTVAFVLSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHFYGTAPVVVHGTRLP-FLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVIGPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAG 254          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_SYNY3 (Aquaporin Z OS=Synechocystis sp. (strain PCC 6803) GN=aqpZ PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.452e-20
Identity = 76/247 (30.77%), Postives = 117/247 (47.37%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNL---------NNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN-----------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESG--ASNCSKSD--KGLWIYMVAHLYGDCXAVGYKWGKFLTAFGK 870
            M+K +AE +GT++++  GC S V             NE  +   G+++ +GL V    Y+LGHISG HFNP+V+      KRFP  Q+ PYI  QVLG+ +A+  + ++ Q   +        GSN                 + A ++EF++TF  + VI GV TD  A    A  A+G  +    + + PIT  S+N   S   A  C        LW++ +A + G   A G+ +   L   G+
Sbjct:    1 MKKYIAEFIGTFWLVLGGCGSAVFAAFIAAPGGGNTNEFGLGYLGVALAFGLTVFTGAYALGHISGGHFNPAVSFGLWMGKRFPGSQLAPYIGAQVLGAIVASLFIFIVAQGGPN----FSLDGSNPLATNGFGDHSPQGYGFLAALLIEFVLTFIFLIVILGV-TDKTAPAGFAPAAIGLALTLIHLISIPITNTSVNPARSTGVALFCGNPALIGQLWLFWLAPIAGALLA-GFVYHNVLEDLGR 241          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUSU (Aquaporin Z OS=Brucella suis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.104e-19
Identity = 63/215 (29.30%), Postives = 110/215 (51.16%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESG-----ASNCSKSDKGLWIYMVAHLYG 816
            + KL AE  GT++++F GC S ++     ++ +   G+++ +GL V+ + Y++G ISG HFNP+V+++     R P K + PY + QVLG+   A  L ++   K    A  L +           S +   ++E I+T + + +I G +T + A    A +A+GF +    + + P+T  S+N   S      A   + S   LW++ VA L G
Sbjct:    2 LNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLSLTVAGRLPAKDLIPYWVAQVLGAIATAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILG-STSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADTAALSQ--LWLFWVAPLVG 213          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQPZ_CHRVO4.481e-2131.16Aquaporin Z OS=Chromobacterium violaceum GN=aqpZ P... [more]
AQPM_ARCFU7.644e-2134.32Probable aquaporin aqpM OS=Archaeoglobus fulgidus ... [more]
AQPZ_PSEAE9.984e-2130.84Aquaporin Z OS=Pseudomonas aeruginosa GN=aqpZ PE=3... [more]
AQPZ2_RHIME1.703e-2029.86Aquaporin Z 2 OS=Rhizobium meliloti GN=aqpZ2 PE=3 ... [more]
AQPZ2_AGRT52.905e-2028.30Aquaporin Z 2 OS=Agrobacterium tumefaciens (strain... [more]
AQPZ_BRUAB4.955e-2029.77Aquaporin Z OS=Brucella abortus GN=aqpZ PE=3 SV=1[more]
AQPZ_BRUA24.955e-2029.77Aquaporin Z OS=Brucella abortus (strain 2308) GN=a... [more]
NIP41_ORYSJ8.452e-2031.37Aquaporin NIP4-1 OS=Oryza sativa subsp. japonica G... [more]
AQPZ_SYNY38.452e-2030.77Aquaporin Z OS=Synechocystis sp. (strain PCC 6803)... [more]
AQPZ_BRUSU1.104e-1929.30Aquaporin Z OS=Brucella suis GN=aqpZ PE=3 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top