EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ1_RHIME (Aquaporin Z 1 OS=Rhizobium meliloti GN=aqpZ1 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.883e-19
Identity = 68/221 (30.77%), Postives = 106/221 (47.96%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYGDCXAVGYKW 843
            +KL  E LGT++++  GC S V+     ++ + L G+S  +GL V+ + Y++G ISG HFNP+V++  A   R P   +  YIL QV G+  AA  L ++   K D       A           S   A V E ++T + + +I G +T +R     A +A+G  +    + + P+T  S+N   S        D     LW++ VA L G   A G  W
Sbjct:    3 RKLSVEFLGTFWLVLGGCGSAVLAAAFPEVGIGLLGVSFAFGLTVLTMAYAVGGISGGHFNPAVSVGLAVAGRMPPASLVGYILAQVTGAIAAAAVLYVIASGKADFQLGGFAANGYGEHSPGGYSLTAALVTEVVMTAFFLLIILG-STHSRVPVGFAPIAIGLGLTLIHLVSIPVTNTSVNPARSTGQALFVGDWAISQLWLFWVAPLIGAVIA-GIVW 221          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP44_MAIZE (Aquaporin TIP4-4 OS=Zea mays GN=TIP4-4 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.459e-19
Identity = 67/207 (32.37%), Postives = 103/207 (49.76%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLN-----NEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATD-NRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++ ++AE++ T+  +FAG  S +          + +V L  +++   LVV V+V +  H+SG H NP+VT+  A   R    +   Y+  Q+LGSTLA   L  L           L AG   ++  +ME ++TF L+F +     D  RA+G +  L VG  V ANV+   P +GASMN   S G +  +      W+Y V  L G
Sbjct:   18 VRAVLAELILTFLFVFAGVGSAMATGKLAGGGGDTVVGLTAVALAHTLVVAVMVSAGLHVSGGHINPAVTLGLAATGRITLFRSALYVAAQLLGSTLACLLLAFLAVADSGVPVHALGAGVGALRGVLMEAVLTFSLLFAVYATVVDPRRAVGGMGPLLVGLVVGANVLAGGPFSGASMNPARSFGPALVAGVWADHWVYWVGPLIG 224          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ1_AGRT5 (Aquaporin Z 1 OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=aqpZ1 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.459e-19
Identity = 60/212 (28.30%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            +K ++E LGT++++F GC S V      ++ +   G++  +GL V+ + Y++G ISG HFNP+V++      +FP   + PYI+ QVLG+ +AA  L ++   K         A           S + A ++E I+T + + VI G +T  R     A +A+G  +    + + P+T  S+N   S            + LW++ +A + G
Sbjct:    3 RKFISEFLGTFWLVFGGCGSAVFAAAFPELGIGFLGVAFAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGKFPAANLVPYIVAQVLGAVVAAAALYVILTGKAGAEIGGFAANGYGEHSPGGYSLLSALLIEIILTAFFLVVILG-STHGRVPVGFAPVAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPILG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BRUME (Aquaporin Z OS=Brucella melitensis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.212e-19
Identity = 63/215 (29.30%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESG-----ASNCSKSDKGLWIYMVAHLYG 816
            + KL AE  GT++++F GC S ++     ++ +   G+++ +GL V+ + Y++G ISG HFNP+V++      R P K + PY + QVLG+  AA  L ++   K    A  L +           S +   ++E I+T + + +I G +T + A    A +A+GF +    + + P+T   +N   S      A   + S   LW++ VA L G
Sbjct:    2 LNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILG-STSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTWVNPARSTGVALFADTAALSQ--LWLFWVAPLVG 213          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPM_METTH (Aquaporin aqpM OS=Methanobacterium thermoautotrophicum GN=aqpM PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.478e-19
Identity = 69/231 (29.87%), Postives = 110/231 (47.62%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLN-----------NEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXA-GSNI--------QAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGA---SNCSKSDKGLWIYMVAHLYG 816
            V   ++ +AE +GT+F++F G  +  + L            N  I  L G      I + +G  +   +Y+LG+ISG H NP+VTI   + K+FP + V PYI+ Q+LG+  A+     +F +     A T+   G+          QA + E + TF LM  I G+A D RA    AG+ +G TV   +     ITG+S+N   +     ++   +   LW Y   ++ G
Sbjct:    2 VSLTKRCIAEFIGTFFLVFFGAGAAAITLMIASGGTAPNPFNIGIGLLGGLGDWVAIGLAFGFAIAASIYALGNISGCHINPAVTIGLWSVKKFPGRDVVPYIIAQLLGAAFAS----FIFLQCAGITAATIGGLGATAPFPGIGYWQAMLAETVGTFLLMITIMGIAVDERAPKGFAGIIIGLTVAGIITTIGNITGSSLNPARTFGPYLNDMVFAGTNLWNYFPIYVIG 228          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP_HAEIX (Aquaporin OS=Haematobia irritans exigua PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.220e-18
Identity = 68/207 (32.85%), Postives = 103/207 (49.76%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEK-------QDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++LMAE++GT+F++  G  S      +E   S+P I+  +GL V  L  ++GHISG H NP+VT+           +   YI  Q +G+   A  +++   E           F+ TL  G   QA ++E +ITF L+ V+ GV+   R  I   A LAVG ++ A  + A  +TGASMN   S G +         W+Y V  + G
Sbjct:   24 RQLMAELIGTFFLVVIGVGSCTGG--SEWSPSIPQIAFTFGLTVATLAQAIGHISGCHINPAVTVGFLIVGEMSIIKSVLYIAVQCVGAIAGAAVIKVGVSEAVSGLDLGVSSFSSTLTVG---QAVLIEALITFILVVVVKGVSDPGRTDIKGSAPLAVGLSIAAGHLCAIKLTGASMNPARSFGPAVVQNMWIDHWVYWVGPIVG 225          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP21_ARATH (Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 7.911e-18
Identity = 66/212 (31.13%), Postives = 102/212 (48.11%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            FS+  ++  +AE + T   +FAG  S +    L ++  +  PG   I++  G  + V V    +ISG H NP+VT   A   +        Y + Q+LGST A   L+ +                +I+  VME IITF L++ +   A D +  ++G +A LA+G  V AN++ A P +G SMN   S G +  +    G W+Y V  L G
Sbjct:   13 FSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAIAVCHGFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVTGGLAVPTHSVAAGLGSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIGLIVGANILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIG 224          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPM_METTM (Aquaporin aqpM OS=Methanobacterium thermoautotrophicum (strain Marburg / DSM 2133) GN=aqpM PE=1 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 7.911e-18
Identity = 64/202 (31.68%), Postives = 98/202 (48.51%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLN-----------NEKIVSLPG------ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TL---------XAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            V   ++ +AE +GT+ ++F G  S  V L            N  I  L G      I + +G  +   +Y+LG+ISG H NP+VTI   + K+FP ++V PYI+ Q+LG+   +     +F +     A T+            S  QA + E + TF LM  I G+A D RA    AG+ +G TV   +     I+G+S+N
Sbjct:    2 VSLTKRCIAEFIGTFILVFFGAGSAAVTLMIASGGTSPNPFNIGIGLLGGLGDWVAIGLAFGFAIAASIYALGNISGCHINPAVTIGLWSVKKFPGREVVPYIIAQLLGAAFGS----FIFLQCAGIGAATVGGLGATAPFPGISYWQAMLAEVVGTFLLMITIMGIAVDERAPKGFAGIIIGLTVAGIITTLGNISGSSLN 199          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP_ANTMA (Probable aquaporin TIP-type OS=Antirrhinum majus GN=DIP PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.926e-17
Identity = 70/228 (30.70%), Postives = 107/228 (46.93%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWGK-FLTA 861
            FSV  ++  +AE + T   +FAG  S +    L ++  +   G   +++     + V V    ++SG H NP+VT+  A            Y + Q LGST+A   L+ +                 IQ  VME IITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  S      WIY    L G   A G+ +G  F+TA
Sbjct:   13 FSVASIKAYVAEFIATLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAVAHAFALFVGVSMAANVSGGHLNPAVTLGLAVGGNITILTGLFYWIAQCLGSTVACLLLKFVTNGLSVPTHGVAAGMDAIQGVVMEIIITFALVYTVYATAADPKKGSLGVIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGDFSQNWIYWAGPLIGGALA-GFIYGDVFITA 239          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP43_ORYSJ (Probable aquaporin TIP4-3 OS=Oryza sativa subsp. japonica GN=TIP4-3 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.926e-17
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLN----NEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF--QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR-AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            ++ ++AE+L T+  +F+G  S +         + I+ L  ++    LVV V+V +  H+SG H NP+VT+  A        +   Y   Q+LGS+LA   L  L   +E     A     G+  +A  ME ++TF L+F +     D R A+G L  L VG  V AN++   P +GASMN   S G +  +      WIY V  L G
Sbjct:   18 LRAVVAELLLTFLFVFSGVGSAMAAAKLGGGGDTIMGLTAVAAAHALVVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYAAAQLLGSSLACLLLAALTGGEEAVPVHAPAPGVGA-ARAVAMEAVLTFSLLFAVYATVVDRRRAVGALGPLLVGLVVGANILAGGPYSGASMNPARSFGPALAAGEWADHWIYWVGPLIG 223          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
AQPZ1_RHIME1.883e-1930.77Aquaporin Z 1 OS=Rhizobium meliloti GN=aqpZ1 PE=3 ... [more]
TIP44_MAIZE2.459e-1932.37Aquaporin TIP4-4 OS=Zea mays GN=TIP4-4 PE=2 SV=1[more]
AQPZ1_AGRT52.459e-1928.30Aquaporin Z 1 OS=Agrobacterium tumefaciens (strain... [more]
AQPZ_BRUME3.212e-1929.30Aquaporin Z OS=Brucella melitensis GN=aqpZ PE=3 SV... [more]
AQPM_METTH5.478e-1929.87Aquaporin aqpM OS=Methanobacterium thermoautotroph... [more]
AQP_HAEIX1.220e-1832.85Aquaporin OS=Haematobia irritans exigua PE=2 SV=1[more]
TIP21_ARATH7.911e-1831.13Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1... [more]
AQPM_METTM7.911e-1831.68Aquaporin aqpM OS=Methanobacterium thermoautotroph... [more]
TIP_ANTMA3.926e-1730.70Probable aquaporin TIP-type OS=Antirrhinum majus G... [more]
TIP43_ORYSJ3.926e-1732.37Probable aquaporin TIP4-3 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top