EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y019_THEMA (Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima GN=TM_0019 PE=3 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 69/218 (31.65%), Postives = 106/218 (48.62%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVE--LDVS------ANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE--ITEGLMKKDWLNNVASRTYP 625
            TG   G+G       A+ G ++V A            EI++++G     M  E  LDV+      A+  +++N V+   E +G +D LVNNA V  +VKS  +   EEW  +++ NLTG ++ S+Y C         G +INI+S  A      P    Y++SK GL A+T  L++ L  + IRV SI PG  ++     + L KK  L  +    +P
Sbjct:   10 TGGGQGIGAAIAQLFAENGMKVVIA------------EIDEEAGVEREEMLRERGLDVTFVKTDVADENSVKNMVRKTVEIYGGVDVLVNNAAVM-SVKSIFERPLEEWERVIRVNLTGPYICSRY-CAEEMIKRGGGVIINIASTRAFQSE--PDTEPYSASKGGLVALTHSLAVSLSRYHIRVVSISPGWIETSEWKKKSLRKKPDLRPIDHEQHP 211          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HSD_MYCTU (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis GN=fabG3 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 75/239 (31.38%), Postives = 115/239 (48.12%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVA---YASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            +G + G+G      +   G ++V      +  K++  E+      +  A  V LDV+   A    +V  A  AFG +  LVNNAG+   + +  D    EW  I+  NLTG +L  + V   M++A + GS+INISSI       L G VA   Y ++K  +  +TK  +LELG   IRVNSI PGL K+ +T+ + +  +   +     P+         +++LV YL  D S    G
Sbjct:   13 SGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAEL------ADAARYVHLDVT-QPAQWTAAVDTAVTAFGGLHVLVNNAGILN-IGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGR-GSIINISSIEG-----LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQTALGRAAEPVE--------VSNLVVYLASDESSYSTG 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HSD_MYCBO (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis GN=fabG3 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 75/239 (31.38%), Postives = 115/239 (48.12%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVA---YASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            +G + G+G      +   G ++V      +  K++  E+      +  A  V LDV+   A    +V  A  AFG +  LVNNAG+   + +  D    EW  I+  NLTG +L  + V   M++A + GS+INISSI       L G VA   Y ++K  +  +TK  +LELG   IRVNSI PGL K+ +T+ + +  +   +     P+         +++LV YL  D S    G
Sbjct:   13 SGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAEL------ADAARYVHLDVT-QPAQWTAAVDTAVTAFGGLHVLVNNAGILN-IGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGR-GSIINISSIEG-----LAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQTALGRAAEPVE--------VSNLVVYLASDESSYSTG 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HDHA_ECOLI (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 59/213 (27.70%), Postives = 104/213 (48.83%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            TGA +G+G+E  +  A AG  +V +    D    + DEI +  G   +A A   D+++    +      A    G++D LVNNAG  G    P D+   ++    + N+   + +S+ V   M + N  G ++ I+S+AA ++       +YASSKA  + + + ++ +LG   IRVN I PG   ++  + ++  +    +   T P+R  G
Sbjct:   17 TGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG---QAFACRCDITSE-QELSALADFAISKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEM-EKNGGGVILTITSMAAENKN--INMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHT-PIRRLG 219          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HDHA_ECO57 (7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 59/213 (27.70%), Postives = 104/213 (48.83%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            TGA +G+G+E  +  A AG  +V +    D    + DEI +  G   +A A   D+++    +      A    G++D LVNNAG  G    P D+   ++    + N+   + +S+ V   M + N  G ++ I+S+AA ++       +YASSKA  + + + ++ +LG   IRVN I PG   ++  + ++  +    +   T P+R  G
Sbjct:   17 TGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG---QAFACRCDITSE-QELSALADFAISKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEM-EKNGGGVILTITSMAAENKN--INMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHT-PIRRLG 219          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_BOVIN (Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 65/202 (32.18%), Postives = 97/202 (48.02%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSV---RAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA+SGLGRE       AG R+V   R  + L+ L  E+       V   +   V  D+ A+  AI  +     + FG +D L+NNAG+S  GA+   +D + +    +M+TN  G   ++K +   M    ++G V+ ISSI    +  LP   AYA+SK    A   CL  E+  H I V  I PG   + ++   +  D
Sbjct:   58 TGATSGLGRECARVFHAAGARLVLCGRNAEALEELSQELAASRAPGVQTHKPCTVTFDL-ADPGAIAGAASEILQCFGHVDVLINNAGISYRGAI---VDTSPDVDKRVMETNYFGPVALTKALLPAM-IRRRQGHVVAISSI--QGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTAD 252          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y1430_HAEIN (Probable NADP-dependent dehydrogenase HI1430 OS=Haemophilus influenzae GN=HI1430 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.743e-15
Identity = 60/185 (32.43%), Postives = 98/185 (52.97%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL 553
            TGA++G G   C  L +AG +++   RR DRL     EI+ Q G++   +A ++ D  A   A+ N++   W+A   +D LVNNAG++  ++       ++W  ++ TN+ G   +++ V   M  A   G +IN+SSIA T      G   Y  +KA +   +  L  +L   KIRV+++ PGL
Sbjct:    9 TGATAGFGLAICKKLIEAGYKVIGTGRRADRLA----EIHSQLGNNFLPLAFDIRDEQATINAL-NTLPEGWQA---VDLLVNNAGLALGLEPAHKADLQDWYQMIDTNIKGLVTITRLVLPNM-VARNYGQIINLSSIAGTY--PYAGSNVYGGTKAFVTQFSLNLRADLAGTKIRVSNVEPGL 182          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_PONAB (Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.277e-15
Identity = 68/236 (28.81%), Postives = 107/236 (45.34%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+   +      +  + G SV      +  + +    E  V  A +  G ID LV+NA V+    S +D+TEE W+  +  N+    L++K V   M +    GSV+ +SSIAA S    PG   Y  SK  L  +TK L++EL    IRVN + PGL K+  +  L            T  +R  G  +     +V +L  + +    G
Sbjct:   20 TASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGE-GLSVTGTVCHVGKAEDR---ERLVATAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEM-EKRGGGSVVIVSSIAAFSPS--PGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDC-AGIVSFLCSEDASYITG 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_HUMAN (Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.277e-15
Identity = 68/236 (28.81%), Postives = 107/236 (45.34%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+   +      +  + G SV      +  + +    E  V  A +  G ID LV+NA V+    S +D+TEE W+  +  N+    L++K V   M +    GSV+ +SSIAA S    PG   Y  SK  L  +TK L++EL    IRVN + PGL K+  +  L            T  +R  G  +     +V +L  + +    G
Sbjct:   20 TASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGE-GLSVTGTVCHVGKAEDR---ERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEM-EKRGGGSVVIVSSIAAFSPS--PGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDC-AGIVSFLCSEDASYITG 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB8_CANFA (Estradiol 17-beta-dehydrogenase 8 OS=Canis familiaris GN=HSD17B8 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.277e-15
Identity = 62/203 (30.54%), Postives = 102/203 (50.25%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMA-------VELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TGA SG+GR   + LAK G  +  AA  +DR  + C+ +    G     +A        + DVS  GA +   ++     F R  ++V +       +  L ++E++W+ ++  NL G +LV++     +  +   GS+INISSI         G   YA+SKAG+  +T+  + ELG H IR NS+ PG   + +T+ + +K
Sbjct:   15 TGAGSGIGRAVSVRLAKEGATV--AACDLDRAAA-CETVWLLGGQGSEKVAPGGAHTAFQADVSEAGA-VRRLLEQVQACFSRPPSVVVSCAGLTRDEFLLRMSEDDWDRVIAVNLKGIFLVTQAAAQALVSSGCRGSIINISSIVGKVGNV--GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFITTPMTQKVPQK 211          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
Y019_THEMA1.335e-1531.65Uncharacterized oxidoreductase TM_0019 OS=Thermoto... [more]
HSD_MYCTU1.335e-1531.383-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
HSD_MYCBO1.335e-1531.383-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
HDHA_ECOLI1.335e-1527.707-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
HDHA_ECO571.335e-1527.707-alpha-hydroxysteroid dehydrogenase OS=Escherichi... [more]
DRS7B_BOVIN1.335e-1532.18Dehydrogenase/reductase SDR family member 7B OS=Bo... [more]
Y1430_HAEIN1.743e-1532.43Probable NADP-dependent dehydrogenase HI1430 OS=Ha... [more]
DHRS4_PONAB2.277e-1528.81Dehydrogenase/reductase SDR family member 4 OS=Pon... [more]
DHRS4_HUMAN2.277e-1528.81Dehydrogenase/reductase SDR family member 4 OS=Hom... [more]
DHB8_CANFA2.277e-1530.54Estradiol 17-beta-dehydrogenase 8 OS=Canis familia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top