EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB8_PIG (Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN=HSD17B8 PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.517e-14
Identity = 68/240 (28.33%), Postives = 117/240 (48.75%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA----ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA SG+GR   + LA  G  + A     A   + ++ L    +++   S    A + DVS    A     Q+    F     +V+ AG++   +  L ++E++W+ ++  NL G +LV++     +  +   GS+INISSI         G   YA+SKAG+  +T+ ++ ELG ++IR NS+ PG  K+ + + + +K  L+ V     P+   G   P +  +V +L  + S    G
Sbjct:   15 TGAGSGIGRAVSVRLAAEGAAVAACDLDGAAAQETVQLLGGPGSEKGAPSGPMAAFQADVSEAETARRLLEQVQAYFFRPPSVVVSCAGITRD-EFLLRMSEDDWDKVIAVNLKGIFLVTQAAAQALVSSGCPGSIINISSIIGKVGNM--GQTNYAASKAGVIGLTQAVARELGRYRIRCNSVLPGFIKTPMAQKVPQK-VLDKVVG-MIPMGHLG-GPPDVADVVAFLASEDSGYITG 248          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YXJF_BACSU (Uncharacterized oxidoreductase yxjF OS=Bacillus subtilis GN=yxjF PE=3 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 4.294e-14
Identity = 54/190 (28.42%), Postives = 100/190 (52.63%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA+ G+G E   + A+ G  ++ +  R +  +    ++ ++      A A+  DV+   A + ++V +  + +GR+D LVNNAG+     +P++    + +  ++K  LT  ++  K+V   M+   Q G +INI+S+         G  AY S+K G+  +TK  +LE   H I VN++CPG   +++
Sbjct:    9 TGAAGGIGFEIAREFAREGASVIVSDLRPEACEKAASKLAEEGFD---AAAIPYDVTKE-AQVADTVNVIQKQYGRLDILVNNAGIQHV--APIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKK-QQFGRIINIASVNGLVG--FAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQL 189          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: THR1_GLOLA (Trihydroxynaphthalene reductase OS=Glomerella lagenarium GN=THR1 PE=3 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 4.294e-14
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEA---FGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA  G+GRE  ++L + G +++   A   +  + +   I K+SGS   +      + AN + ++  V+M  EA   +GR+D + +N+GV   G VK   D+T EE++ +   N  G + V++      +     G +I + SI   ++G +P    Y+ SK  +    +C++++ G  KI VN++ PG  K+++
Sbjct:   35 TGAGRGIGREMAMELGRRGAKVIVNYANSAETAEEVVQAI-KKSGSDAAS------IKANVSDVDQIVKMFGEAKQIWGRLDIVCSNSGVVSFGHVK---DVTPEEFDRVFAINTRGQFFVAREA---YKHLEVGGRLILMGSITGQAKG-VPKHAVYSGSKGTIETFVRCMAIDFGDKKITVNAVAPGGIKTDM 215          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_RICTY (3-oxoacyl-[acyl-carrier-protein] reductase OS=Rickettsia typhi GN=fabG PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.294e-14
Identity = 56/196 (28.57%), Postives = 98/196 (50.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TGAS G+G      L K G +++ +     +LK L + +            +E+   AN     N +         +D LV NAG++    + + + +++++ ++  NL  ++++++    +M    + G +INISSI   +    PG   Y +SKAGL  MTK LS E+    I VN++ PG  KS++T+ L +K
Sbjct:   12 TGASGGIGSAIARLLHKLGSKVIISGSNEKKLKLLGNTLKDN-------YIIEVCNLANKEECNNLISK----ISNLDILVCNAGITSDTLA-IRMKDQDFDKVIDINLKANFILNREAIKKMIQ-KRYGRIINISSIVGIAGN--PGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEK 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS7_ANOGA (Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 4.294e-14
Identity = 62/195 (31.79%), Postives = 99/195 (50.77%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGS--SVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS---GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGASSGLG         AGC++V AARR D L+ +  ++ +   +  +   + + LD+S +  +I   VQ   E  G ID LVNN G+S    A+ + +D+       IM  N  GS  ++K  C+    A +EG +++ISS+    +  +P   AY++SK  + A    L  E+    I+V  I PG   + ++
Sbjct:   54 TGASSGLGEALAHSFFLAGCKVVLAARRKDELERVRKDLLELHATVPTHPPIILPLDLS-DLNSIGGKVQSVLEIHGAIDILVNNGGISVRGDALSTAIDVD----IRIMLVNYFGSVALTK-ACLPSMMARKEGRIVSISSV--QGKFAIPHRSAYSASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTALS 240          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_HUMAN (Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 4.294e-14
Identity = 62/214 (28.97%), Postives = 102/214 (47.66%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTT 646
            G S G+GR     +A+ G R+   AR ++  K+   ++          +A   DV A    ++N+ +   +  GR++ LVN AG++         TE+  + +  TNL GS L  K   +R     Q GS++N+ SI         G   Y++SK GL   ++ L+ E+   KIRVN + PG   +++T+ L ++    N+     PL  FG T
Sbjct:    9 GGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDH------LAFSCDV-AKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQL-HTNLLGSMLTCK-AAMRTMIQQQGGSIVNVGSIVGLKGNS--GQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNI-----PLGRFGET 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2567_STAAR (Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 53/190 (27.89%), Postives = 98/190 (51.58%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA SG+G      L + G ++V A R  D+L+++ +++ + S        V  DV+     ++  ++MA + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   +K     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKDKLQNVANQLAQDS-----VKVVPTDVTKK-EEVDELIKMAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAKAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT 191          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: T4HR_MAGGR (Tetrahydroxynaphthalene reductase OS=Magnaporthe grisea GN=MGG_02252 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 55/202 (27.23%), Postives = 103/202 (50.99%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEA---FGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TGA  G+GRE  ++L + GC+++   A   +  + +   I K++GS          V AN   +E+ V+M  EA   FG++D + +N+GV   G VK   D+T EE++ +   N  G + V++     +      G +I + SI   ++  +P    Y+ SK  +    +C+++++   KI VN + PG  K+++   + ++
Sbjct:   35 TGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAI-KKNGSDAAC------VKANVGVVEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVK---DVTPEEFDRVFTINTRGQFFVAREAYKHLEIG---GRLILMGSITGQAKA-VPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCRE 222          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHSO_RHOSH (Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 58/196 (29.59%), Postives = 102/196 (52.04%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TG++ G+GR F     + G R+  A   ++  ++   EI         A A+ LDV+ + A+I+  V    + +G ID LVNNA +   +   +++T E ++ +   N++G+  + + V   M    + G +IN++S  A  RG+   GV Y ++KA + ++T+   L L  H I VN+I PG+   E  +G+  K
Sbjct:   11 TGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEIGP------AACAIALDVT-DQASIDRCVAELLDRWGSIDILVNNAALFD-LAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMAS-QAGRRGEALVGV-YCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAK 196          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_RABIT (Dehydrogenase/reductase SDR family member 4 OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 60/193 (31.09%), Postives = 94/193 (48.70%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            T ++ G+G      LA+ G  +V ++R+   +      +  + G SV      +  + +    E  V  A    G ID LV+NA V+      +D+TEE W+ I+  N+    L++K V   M +    GSV+ ++SIAA +     G   Y  SK  L  +TK L+LEL    IRVN + PGL K+  ++ L
Sbjct:   20 TASTDGIGLAIARRLAQDGAHVVISSRKQQNVDRAVAALQAE-GLSVTGTVCHVGKAEDR---ERLVATALNLHGGIDILVSNAAVNPFFGKLMDVTEEVWDKILDINVKAMALMTKAVVPEM-EKRGGGSVVIVASIAAFN--PFSGLGPYNVSKTALVGLTKNLALELAAQNIRVNCLAPGLIKTSFSKAL 205          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DHB8_PIG2.517e-1428.33Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN... [more]
YXJF_BACSU4.294e-1428.42Uncharacterized oxidoreductase yxjF OS=Bacillus su... [more]
THR1_GLOLA4.294e-1428.21Trihydroxynaphthalene reductase OS=Glomerella lage... [more]
FABG_RICTY4.294e-1428.573-oxoacyl-[acyl-carrier-protein] reductase OS=Rick... [more]
DHRS7_ANOGA4.294e-1431.79Dehydrogenase/reductase SDR family protein 7-like ... [more]
CBR4_HUMAN4.294e-1428.97Carbonyl reductase family member 4 OS=Homo sapiens... [more]
Y2567_STAAR5.608e-1427.89Uncharacterized oxidoreductase SAR2567 OS=Staphylo... [more]
T4HR_MAGGR5.608e-1427.23Tetrahydroxynaphthalene reductase OS=Magnaporthe g... [more]
DHSO_RHOSH5.608e-1429.59Sorbitol dehydrogenase OS=Rhodobacter sphaeroides ... [more]
DHRS4_RABIT5.608e-1431.09Dehydrogenase/reductase SDR family member 4 OS=Ory... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top