EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_PIG (Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 63/236 (26.69%), Postives = 107/236 (45.34%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+ + +      +  + G SV      +  + +    E  V MA    G +D LV+NA V+    + +D TEE W+ I+  N+  + L++K V   M +    GSV+ +SS+ A      P    Y  SK  L  +TK L++EL    IRVN + PGL K+  ++ L            +  +R  G  +     +V +L  + +    G
Sbjct:   20 TASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGE-GLSVTGTVCHVGKAEDR---ERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEM-EKRGGGSVLIVSSVGAYH--PFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDC-AGIVSFLCSEDASYITG 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_CAVPO (L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.608e-14
Identity = 64/183 (34.97%), Postives = 90/183 (49.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TGA  G+GR   L L  AG ++VA +R  + L  L  E        V  + V+L D  A   A+ N         G  D LVNNA V+  ++  L++T+E        NL     VS+ V   M      G+++N+SS A  S+  L     Y S+K  L  +TK ++LELG HKIRVN++ P
Sbjct:   13 TGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVREC-----PGVEPVCVDLADWEATEQALSN--------VGPADLLVNNAAVA-LLQPFLEVTKEACVTSFNVNLRAVIQVSQIVAKGMIARGVPGAIVNVSSQA--SQRALTNHTVYCSTKGALYMLTKMMALELGPHKIRVNAVNP 179          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_BOVIN (Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.973e-14
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            G S G+GR     +A+ G R+   AR ++  ++   ++          +A+  DV A    ++N+ +   +  GR++ LVN AG++         TE+  + +  TNL GS L  +   ++     Q GS++N+ S+         G   Y++SK GL   ++ L+ E+   KIRVN + PG   +++T     KD    +  +  PL  FG
Sbjct:    9 GGSRGIGRAVARLMAQRGYRLAIVARNLEGARAAAGDLGGDH------LALSCDV-AKEHDVQNTFEEIEKNLGRVNFLVNAAGINRDNLLVRTNTEDMLSQL-HTNLLGSMLTCR-AALKTMIKQQRGSIVNVGSVVGLKGNS--GQSVYSASKGGLVGFSRALAKEVAKKKIRVNVVAPGFIHTDMT-----KDLNEELLKKNIPLGRFG 204          

HSP 2 Score: 23.483 bits (49), Expect = 5.973e-14
Identity = 14/40 (35.00%), Postives = 20/40 (50.00%), Query Frame = 1
Query:  613 KNLPFKRFRHHRPRTDIACSVPGS*LF*YVSGHIFIVDSG 732
            KN+P  RF       D+A +        YV+GH+ +VD G
Sbjct:  196 KNIPLGRFGD---ALDVAQAAVFLLESPYVTGHVLVVDGG 232          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: SDH_RHIRD (Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.324e-14
Identity = 57/190 (30.00%), Postives = 98/190 (51.58%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA+SG G+       K G +++   RR +RL++L  E+    GS+   +A ++    +  A + ++    + F  ID LVNNAG++        +  ++W  ++ TN+TG   V+ ++   +    ++G VIN+SS+AA       GG  Y  +KA L   +  L  +L    +RV SI PG+ ++E T
Sbjct:    8 TGATSGFGQATAQRFVKEGWKVIGTGRRAERLEALSAEL----GSAFHGVAFDI---TDEEATKKALAGLPDGFRDIDILVNNAGLALGTAPAPQVPLKDWQTMVDTNITGLLNVTHHLLPTL--IERKGIVINLSSVAA--HYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEFT 186          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCDS_XANP2 (2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.565e-14
Identity = 66/221 (29.86%), Postives = 112/221 (50.68%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTE-EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG-LFKSEITEGLMKKDWLNNVASR---TYPLRDFGTTD 649
            TG ++G+G    L +A A  R  A    +DR  +       + G++  A  V  DV+ + AAI  ++  A  A G +  LVNNAG++G     +  TE E W+ IM  N+TG++L SK     M +  + G+++N  S+A      +P   AY ++K  +  +T+ ++ +     IRVN +CPG +  +++   L+  D    + +R    YP+  FGT +
Sbjct:   10 TGGAAGIG----LAVAHAAIRAGARVALIDRDGACAQRAAAEFGAA--AWGVGADVT-DEAAITAAMAGAQRALGPLTGLVNNAGIAGF--GSVHATEVETWSRIMAVNVTGTFLASKAALFGMLERGR-GAIVNFGSVAGLVG--IPTMAAYCAAKGAVVNLTRQMAADYSGRGIRVNVVCPGTVAGTDMGRQLLGTDCDPELEARRLAKYPMGRFGTPE 218          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABL_BACSU (Enoyl-[acyl-carrier-protein] reductase [NADPH] OS=Bacillus subtilis GN=fabL PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.565e-14
Identity = 70/243 (28.81%), Postives = 111/243 (45.68%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI------TEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG+S G+G+   + LA+ G  IV   AR         +EI K     V+ + V+ +V    A I+   Q   E FGR+D  VNNA  SG ++  ++L E  W+  M  N   + L       ++ + N  G +++ISS+   S   L        SKA L A+T+ L++EL   +I VN++  G   ++        E L++    N  A R   ++D       +   V +LV   +DM  G
Sbjct:   10 TGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLG---VKVLVVKANVG-QPAKIKEMFQQIDETFGRLDVFVNNA-ASGVLRPVMELEETHWDWTMNIN-AKALLFCAQEAAKLMEKNGGGHIVSISSLG--SIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKD-------MVDTVEFLVSSKADMIRG 237          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS2_HUMAN (Dehydrogenase/reductase SDR family member 2 OS=Homo sapiens GN=DHRS2 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 9.565e-14
Identity = 59/191 (30.89%), Postives = 98/191 (51.31%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TG++SG+G      LA+ G  +V ++R+   +     ++  + G SV  +   +  + +    E  V  A E  G +D LV +AGV+  V S L  +E+ W+ I+  N+    L+   +   M   N+ G+VI +SSIAA +     G   Y  SK  L  +T+ L+LEL    IRVN + PG+ K++ ++
Sbjct:   20 TGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGE-GLSVAGIVCHVGKAEDR---EQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYME--NRRGAVILVSSIAAYNPVVALG--VYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSK 202          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YM71_YEAST (Uncharacterized oxidoreductase YMR226C OS=Saccharomyces cerevisiae GN=YMR226C PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.249e-13
Identity = 59/193 (30.57%), Postives = 99/193 (51.30%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAG---CRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGAS+G+G+   L+  +A     +++ AARR+++L+ L   I+ Q   + +    +LD++     I+  ++   + F  ID LVNNAG +        +  E+   +  TN+T    +++ V + +  A   G ++N+ SIA   R   P G  Y +SK  + A T  L  EL   KIRV  I PGL ++E +
Sbjct:   19 TGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTID-QEFPNAKVHVAQLDIT-QAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAV-LPIFQAKNSGDIVNLGSIAG--RDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEFS 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: TRN2_HYONI (Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.249e-13
Identity = 55/191 (28.80%), Postives = 93/191 (48.69%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TG S G+G     +LA  G  +   +R    L   C    +  G +V A   +L   +       +V   +   G+++ LVNNAG+    K   D T E+++HIM  N   ++ +S      ++ A++ G+V+ ISSI+  S   LP    Y ++K  ++ +T+CL+ E     IRVN + PG+  + + E
Sbjct:   15 TGGSRGIGYGIVEELANLGASVYTCSRNQKELDE-CLTQWRSKGFNVEASVCDLSSRSEREEFMKTVSNHFH--GKLNILVNNAGIV-IYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLK-ASERGNVVFISSISGASA--LPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVE 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: NODG_RHIME (Nodulation protein G OS=Rhizobium meliloti GN=nodG PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.249e-13
Identity = 63/236 (26.69%), Postives = 108/236 (45.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS  +G      L   G  +     ++++L++L  E+    G  V+     L   AN   ++   Q A      +D LVNNAG++      L + + +W+ +++ NLT  + +++ +  +M    + G +IN++S+A       PG   Y +SKAG+   +K L+ E+    I VN + PG  +S +T+ L  K           P+   G T   + S V YL  D +    G
Sbjct:   12 TGASGAIGGAIARVLHAQGAIVGLHGTQIEKLETLATEL----GDRVKLFPANL---ANRDEVKALGQRAEADLEGVDILVNNAGITKDGLF-LHMADPDWDIVLEVNLTAMFRLTREITQQMI-RRRNGRIINVTSVAGAIGN--PGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAMTDKLNHKQ--KEKIMVAIPIHRMG-TGTEVASAVAYLASDHAAYVTG 233          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DHRS4_PIG5.608e-1426.69Dehydrogenase/reductase SDR family member 4 OS=Sus... [more]
DCXR_CAVPO5.608e-1434.97L-xylulose reductase OS=Cavia porcellus GN=DCXR PE... [more]
CBR4_BOVIN5.973e-1426.89Carbonyl reductase family member 4 OS=Bos taurus G... [more]
SDH_RHIRD7.324e-1430.00Serine 3-dehydrogenase OS=Rhizobium radiobacter GN... [more]
HCDS_XANP29.565e-1429.862-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobac... [more]
FABL_BACSU9.565e-1428.81Enoyl-[acyl-carrier-protein] reductase [NADPH] OS=... [more]
DHRS2_HUMAN9.565e-1430.89Dehydrogenase/reductase SDR family member 2 OS=Hom... [more]
YM71_YEAST1.249e-1330.57Uncharacterized oxidoreductase YMR226C OS=Saccharo... [more]
TRN2_HYONI1.249e-1328.80Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 P... [more]
NODG_RHIME1.249e-1326.69Nodulation protein G OS=Rhizobium meliloti GN=nodG... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top