EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2403_STAAW (Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 52/197 (26.40%), Postives = 100/197 (50.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA SG+G      L + G ++V A R  ++L+++ +++++ S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+ L +    +        G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT      D
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDS-----VKVVPTDVT-NKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGT-LYTVQAALPTMLEQSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPSD 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2370_STAAS (Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 52/197 (26.40%), Postives = 100/197 (50.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA SG+G      L + G ++V A R  ++L+++ +++++ S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+ L +    +        G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT      D
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDS-----VKVVPTDVT-NKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGT-LYTVQAALPTMLEQSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPSD 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y0585_STAHJ (Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 58/191 (30.37%), Postives = 94/191 (49.21%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGASSG+G      L K G ++V A R  D+L +L  ++N+ +        V  DV+ N   ++  V    + FG +D  VN AGV  + K   D   E W+ ++ TN+ G  L S    +   +A   G V+N++SI+A    +      Y+++K+ +  +   L  EL    I+  SI PG+  + +TE
Sbjct:   12 TGASSGIGAATAKALEKQGVKVVLAGRSHDKLNTLAKDMNEDN-----IHIVPTDVT-NQVEVDALVAKVIDVFGHVDIFVNCAGVMRSSKI-TDYQVESWDSMVDTNIKG-LLYSLNAILPKFEAQGSGHVVNLASISANEVSK--ESALYSATKSAVLMIFNGLEKELAKTGIKTTSILPGMVDTPMTE 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PECR_CAVPO (Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 62/240 (25.83%), Postives = 114/240 (47.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVS-ANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI---TEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG  +G+G+    +L   GC +V A+R+ DRL++  +E+      S +A    +  +      + N ++     +G+ID LVNN G      SP  ++ + W+ +++TNLTG++ + K            G+++NI  +     GQ P      +++ G+  +TK L+L      IR+N + PG   S+      G M K    + A +  P +  G  +  ++SLV +L+  ++    G
Sbjct:   24 TGGGTGIGKAIAKELLHLGCNVVIASRKFDRLRAAAEELKATLPPSNKAEVTPIQCNIRKEEEVNNLMKSTLALYGKIDFLVNNGG-GQFWSSPEHISSKGWHAVIETNLTGTFYMCK-AAYNSWMKEHGGAIVNIIILL---NGQ-PFVAHSGAARGGVYNLTKSLALGWARSGIRINCVAPGTVYSQTAMDNYGDMGKTLFAD-AFQKIPAKRLGVPE-EVSSLVCFLLSPAASFITG 255          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: EPHD_MYCTU (Probable oxidoreductase ephD OS=Mycobacterium tuberculosis GN=ephD PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 60/189 (31.75%), Postives = 91/189 (48.15%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA SG+GRE  L  A+ G  IV +      +K    EI  + G    A    LDVS +  A+E   +      G  D +VNNAG+  A +  LD   E+++ ++  NL G     +    R+ +    G ++N+SS+AA +   L    AY +SKA     + CL  EL    + + +ICPG+  + I
Sbjct:  330 TGAGSGIGRETALAFAREGAEIVISDIDEATVKDTAAEIAARGGI---AYPYVLDVS-DAEAVEAFAERVSAEHGVPDIVVNNAGIGQAGRF-LDTPAEQFDRVLAVNLGGVVNGCRAFGQRLVERGTGGHIVNVSSMAAYA--PLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNI 511          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: EPHD_MYCBO (Probable oxidoreductase ephD OS=Mycobacterium bovis GN=ephD PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.783e-13
Identity = 60/189 (31.75%), Postives = 91/189 (48.15%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA SG+GRE  L  A+ G  IV +      +K    EI  + G    A    LDVS +  A+E   +      G  D +VNNAG+  A +  LD   E+++ ++  NL G     +    R+ +    G ++N+SS+AA +   L    AY +SKA     + CL  EL    + + +ICPG+  + I
Sbjct:  330 TGAGSGIGRETALAFAREGAEIVISDIDEATVKDTAAEIAARGGI---AYPYVLDVS-DAEAVEAFAERVSAEHGVPDIVVNNAGIGQAGRF-LDTPAEQFDRVLAVNLGGVVNGCRAFGQRLVERGTGGHIVNVSSMAAYA--PLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNI 511          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BUTA_STAEQ (Acetoin(diacetyl) reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.635e-13
Identity = 64/202 (31.68%), Postives = 100/202 (49.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQ-SGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE----ITEGLMKKD 592
            TG++ GLG+     LA  G  IV      D  ++L  E  K+      +A+A + DVS      E  VQ A   FG++D +VNNAGV  AV   L++ EEE + +   N+ G+    +    +      +G +IN  SIA     ++ G   Y+++K  + + T+  + EL    I VN+ CPG+ K+E    I E ++K D
Sbjct:    8 TGSAGGLGKGIAERLANDGFNIVLQ----DINEALLLETEKEFKEKGYQAVAFKSDVSKKKEQ-EELVQFAVTEFGQLDVMVNNAGVD-AVTPILEIGEEELSKLFNINVFGTLFGIQAAANQFIKQKSKGKIINACSIAGHESYEVLG--TYSATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWDRIDEEMVKLD 201          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_XENTR (Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.747e-13
Identity = 62/205 (30.24%), Postives = 99/205 (48.29%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK---QSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLN 601
            TGA+SGLGRE       AG R+V   R  + LK+L  E+++   +S    +   V  D+S +  A+ ++        GR+D L+NNAG+S  G +   LD        +M TN  G   ++K   I     N+ G ++ ISS+    +  +P   AY++SK    A   CL  E+  ++I V  + PG  K+ ++   +  D  N
Sbjct:   42 TGATSGLGRECAKVFYAAGTRLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVIFDLS-DVEAVNSAANEILHLTGRVDILINNAGISYRGTI---LDTKVSVDRMVMDTNYFGPVALTK-ALIPSMIKNRRGHIVVISSV--QGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTGDGSN 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_XENLA (Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.747e-13
Identity = 62/198 (31.31%), Postives = 93/198 (46.97%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL------DVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA+SGLG+E       AG  +V   R  +RLK L  E+N     S +     +      DV A   A +  + +A    GR+D L+NNAG+S  G +   LD        +M TN  G   ++K +   M   N+ G V+ ISS+    +  +P   AY++SK    A   CL  E+  + I V  + PG  K+ ++
Sbjct:   42 TGATSGLGKECAKVFYAAGSHLVLCGRDEERLKDLVQELNNMRLKSTQLHKPHMVIFDLSDVEAVNTAAKEILHLA----GRVDILINNAGISYRGTI---LDTKVSVDRMVMDTNYFGPVALTKALLPSM-IKNRRGHVVVISSV--QGKISIPFRSAYSASKHATQAFFDCLRAEMSPYDIDVTVVNPGYIKTNLS 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: GRDH_ORYSJ (Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 6.200e-13
Identity = 68/245 (27.76%), Postives = 107/245 (43.67%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARR-------VDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRD----ANQEG-SVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDM 700
            TG  SG+GR  CL  A  G  +     +        + L++L D   +       A+  +L    N   + + V  A+   G ID LVNNA       S  D+TE++   + +TN+   + +SK+   RMRD    A   G S+IN SSI A    +    + Y ++K  + A T+ L+L+L    IRVN + PG   + +      ++ +    S+  P+   G       S V     D+S M
Sbjct:   46 TGGDSGIGRAVCLCFALEGATVAFTYVKGQEEKDAEETLRALRDIRARTGAKDPMAIPADLGYDDNCRKVVDEVAGAYG--GAIDILVNNAAEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGGCSIINTSSINAYKGNKTL--LDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIPASFAEEKVRQFGSQV-PMGRAGQPSEVAPSFVFLASDDASYM 285          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
Y2403_STAAW2.783e-1326.40Uncharacterized oxidoreductase MW2403 OS=Staphyloc... [more]
Y2370_STAAS2.783e-1326.40Uncharacterized oxidoreductase SAS2370 OS=Staphylo... [more]
Y0585_STAHJ2.783e-1330.37Uncharacterized oxidoreductase SH0585 OS=Staphyloc... [more]
PECR_CAVPO2.783e-1325.83Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia p... [more]
EPHD_MYCTU2.783e-1331.75Probable oxidoreductase ephD OS=Mycobacterium tube... [more]
EPHD_MYCBO2.783e-1331.75Probable oxidoreductase ephD OS=Mycobacterium bovi... [more]
BUTA_STAEQ3.635e-1331.68Acetoin(diacetyl) reductase OS=Staphylococcus epid... [more]
DRS7B_XENTR4.747e-1330.24Dehydrogenase/reductase SDR family member 7B OS=Xe... [more]
DRS7B_XENLA4.747e-1331.31Dehydrogenase/reductase SDR family member 7B OS=Xe... [more]
GRDH_ORYSJ6.200e-1327.76Glucose and ribitol dehydrogenase homolog OS=Oryza... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top