EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BDH2_HUMAN (3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 55/185 (29.73%), Postives = 93/185 (50.27%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGV--SGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            T A+ G+G+   L  A+ G +++A     D  +S   E+ K  G   R + V      +  A  N V+       R+D L N AG    G V   LD  E++W+  M  N+   +L+ K    +M  A + G++IN+SS+A++ +G +   V Y+++KA +  +TK ++ +     IR N +CPG
Sbjct:   12 TAAAQGIGQAAALAFAREGAKVIAT----DINESKLQELEKYPGIQTRVLDVTKKKQIDQFA--NEVE-------RLDVLFNVAGFVHHGTV---LDCEEKDWDFSMNLNVRSMYLMIKAFLPKML-AQKSGNIINMSSVASSVKGVVNRCV-YSTTKAAVIGLTKSVAADFIQQGIRCNCVCPG 178          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: UXUB_BACSU (Uncharacterized oxidoreductase uxuB OS=Bacillus subtilis GN=uxuB PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.579e-11
Identity = 63/244 (25.82%), Postives = 116/244 (47.54%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAG--------------VSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLM-KKDWLNNVASRTY------PLRDFGTTDPALTSLV 670
            TG S  L      +LA+ G ++    R  ++ +++  EI    G+   A AV  DV  +  ++E + +     FG +D L+N AG               +G  +S  D+ E  +  +  TN TG++L S+     +  A+   ++IN+SS++A S   +    AY+++KA +N  T  +++      +RVN+I PG F ++    L+  +D      SR++      P++ FG  +  L +L+
Sbjct:   16 TGGSGVLCSAMARELARHGMKVAILNRTAEKGQAVVKEITAAGGT---ACAVAADV-LDRMSLERAKEDILGQFGAVDLLINGAGGNHPDAITDVETYEEAGEGQSFFDMDERGFLTVFSTNFTGAFLASQVFGKELLKADSP-AIINLSSMSAYS--PMTKVPAYSAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTKQNHDLLINQD--GTFTSRSHKIIAGTPMKRFGKPEDLLGTLL 250          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PGDH_BOVIN (15-hydroxyprostaglandin dehydrogenase [NAD+] OS=Bos taurus GN=HPGD PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.579e-11
Identity = 58/233 (24.89%), Postives = 112/233 (48.07%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNL----TGSWLVSKYVCIRMRDANQEGSVINISSIAATSR-GQLPGGVAYASSKAGLNAMTKCLSLELGVHK--IRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRD----FGTTDPAL 658
            TGA+ G+GR F   L   G ++      ++   + K+  DE  +      + + ++ DV A+   + ++ +   + FG++D LVNNAGV+          E+ W   ++ NL    +G++L   Y+    ++  + G  IN+SS+A      Q P    Y +SK G+   T+  ++   +    +R+N+ICPG   + I + + K++ +        P++D    +G  DP++
Sbjct:   11 TGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVKCKAALDEQFEPQ----KTLFIQCDV-ADQEQLRDTFRKVVDHFGKLDILVNNAGVNN---------EKNWEKTLQINLVSVISGTYLGLDYMS--KQNGGEGGININMSSLAGLMPVAQQP---VYCASKHGIVGFTRSAAMAANLMNSGVRLNAICPGFVDTPILKSIEKEENMGKYIEYMGPIKDMMKYYGILDPSM 224          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: LIMC_RHOER ((-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.579e-11
Identity = 54/192 (28.12%), Postives = 93/192 (48.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLK-----SLCDEINKQSGSSV-----RAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TGA+ G GR   + LA+ G  ++      D +         DE++ Q+   V     +A+ +  DV  +  ++   V  A    GR+D +  NAG++       D+ +  W  ++  NLTG W  +K V +    A + G  I ++S AA  +G       Y+++K G+  + + L+LEL  H++RVNS+ P
Sbjct:   12 TGAARGQGRSHAIKLAEEGADVILVDVPNDVVDIGYPLGTADELD-QTAKDVENLGRKAIVIHADVR-DLESLTAEVDRAVSTLGRLDIVSANAGIASVPFLSHDIPDNTWRQMIDINLTGVWHTAK-VAVPHILAGERGGSIVLTSSAAGLKGYAQIS-HYSAAKHGVVGLMRSLALELAPHRVRVNSLHP 199          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB14_BOVIN (17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.579e-11
Identity = 52/197 (26.40%), Postives = 94/197 (47.72%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEA---FGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISS-IAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TG   G+G        ++G ++V           +CD+   +  +  R +   + +  +    E+   +  E    FGR+D +VNNAG     + P + + + +  +++ NL G++ ++K     +R     G+VINISS + A  + Q    V Y ++K  + AMTK L+L+   + +RVN I PG   + + E L
Sbjct:   15 TGGGRGIGAGIVRAFVESGAQVV-----------ICDKDEARGRAVERELPGTVFLLCDVTREEDVRTLVSETIRRFGRLDCIVNNAGYHPPPQWPEETSAQGFRQLLELNLLGTYTLTKLALPHLR--KSRGNVINISSLVGAIGQSQ---AVPYVATKGAVTAMTKALALDESQYGVRVNCISPGNIWTPLWEEL 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YVRD_BACSU (Uncharacterized oxidoreductase yvrD OS=Bacillus subtilis GN=yvrD PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 49/183 (26.78%), Postives = 87/183 (47.54%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TG++SG+G+       + G  ++   R+ + +    +E++     +V   A +L  +   AA    V       G ID LVNN G    VK   D+T+EEWN   + N+  +   S++   +M  A   G ++NI+S A      LP  + Y+ +K  L ++++ ++       + VNS+ PG
Sbjct:   13 TGSTSGIGKAAAKSFLQEGAAVIVNGRKQETVDRTIEELSGYG--TVHGAAADLSKTDEAAAFIEKVN----EIGDIDILVNNLGFF-EVKDFADVTDEEWNQYFEVNVMSAVRTSRHFLPKML-AKNSGRILNIASEAGVK--PLPTMIPYSMTKTALISLSRGMAEMTKGTNVTVNSVLPG 185          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: GRDH_DAUCA (Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 65/244 (26.64%), Postives = 108/244 (44.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI----VAAARRVDRLKSLCDEINKQSGSSVR---AMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSI-AATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG  SG+GR  C   A  G  +    V      D  ++L + + K   S  +   A+A +L    N   + + V     AFG ID LVNNA       +  D+ EE    + +TN+   + ++++    MR+ +   ++IN +SI A     +L   + Y ++K  + A T+ LSL+L    IRVN + PG   + +      ++ +    S   P++  G      T+ V +L    S  Y G
Sbjct:   47 TGGDSGIGRSVCYHFALEGATVAFTFVKGHEDKDANETL-ELLRKAKSSDAKDPIAIAADLGFDDNCKKVVDQVV---NAFGSIDVLVNNAAEQYKASTVEDIDEERLERVFRTNIFAYFFMARHALKHMREGS---TIINTTSINAYKGNAKL---LDYTATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSSFDEEEVKQFGSEV-PMKRAGQPYEIATAYV-FLASCDSSYYSG 278          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB4_MOUSE (Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 68/249 (27.31%), Postives = 118/249 (47.39%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAA-----RRVDRLKSLCD----EINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGA  GLGR + L  A+ G  ++        + + +  S  D    EI ++ G   +A+A    V A     E  V+ A + FGRID +VNNAG+    +S   +++E+W+ I + +L GS+ V++     M+  N  G ++  SS A+   G   G   Y+++K G+  +   L++E   + I  N+I P    S +TE ++ +D +  +                +  LV +L H+S +   G F +
Sbjct:   15 TGAGGGLGRAYALAFAERGALVIVNDLGGDFKGIGKGSSAADKVVAEIRRKGG---KAVANYDSVEAG----EKLVKTALDTFGRIDVVVNNAGIL-RDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNY-GRILMTSS-ASGIYGNF-GQANYSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNA-GSRMTETVLPEDLVEALKPE------------YVAPLVLWLCHESCEENGGLFEV 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BDHA_RALEH (D-beta-hydroxybutyrate dehydrogenase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 58/188 (30.85%), Postives = 91/188 (48.40%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAA-RRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISS----IAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TG++SG+G      LA  G  I+       D  K+   EI  Q+G  +R      D+S   A IE+ ++ A   FG  D LVNNAG+   V +  D   E W+ I+  NLT ++  ++     M+  +  G +IN++S    +A+  +       AY ++K G+   TK  +LE     +  N+ICPG
Sbjct:   10 TGSTSGIGLGIAKALAAQGANIIVNGFGDADAAKA---EI-AQAGQGIRVGYHGADMS-KAAEIEDMMRYAQSDFGGADILVNNAGIQ-HVAAIEDFPPERWDAIIAINLTSAFHTTRLALPGMKQKDW-GRIINVASTHGLVASAQKS------AYVAAKHGIVGFTKVTALETAQTGVTANAICPG 184          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: ACR1_ACIBI (Fatty acyl-CoA reductase OS=Acinetobacter baylyi GN=acr1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAG--VSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSI 541
            TGASSG+G      +A AG  ++  AR  + L+ +   I +Q G +        D++A    I+   Q    +   +D L+NNAG  +  AV    D   + +   M+ N  G+  +   +   M    + G +INISSI   +        AY +SKA L+A ++CLS E+  HKI + SI
Sbjct:   21 TGASSGIGLTIAKRIAAAGAHVLLVARTQETLEEVKAAIEQQGGQASIFPCDLTDMNA----IDQLSQQIMASVDHVDFLINNAGRSIRRAVHESFDRFHD-FERTMQLNYFGAVRLVLNLLPHMIK-RKNGQIINISSIGVLANATRFS--AYVASKAALDAFSRCLSAEVLKHKISITSI 194          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
BDH2_HUMAN5.803e-1129.733-hydroxybutyrate dehydrogenase type 2 OS=Homo sap... [more]
UXUB_BACSU7.579e-1125.82Uncharacterized oxidoreductase uxuB OS=Bacillus su... [more]
PGDH_BOVIN7.579e-1124.8915-hydroxyprostaglandin dehydrogenase [NAD+] OS=Bo... [more]
LIMC_RHOER7.579e-1128.13(-)-trans-carveol dehydrogenase OS=Rhodococcus ery... [more]
DHB14_BOVIN7.579e-1126.4017-beta-hydroxysteroid dehydrogenase 14 OS=Bos tau... [more]
YVRD_BACSU9.898e-1126.78Uncharacterized oxidoreductase yvrD OS=Bacillus su... [more]
GRDH_DAUCA9.898e-1126.64Glucose and ribitol dehydrogenase OS=Daucus carota... [more]
DHB4_MOUSE9.898e-1127.31Peroxisomal multifunctional enzyme type 2 OS=Mus m... [more]
BDHA_RALEH9.898e-1130.85D-beta-hydroxybutyrate dehydrogenase OS=Ralstonia ... [more]
ACR1_ACIBI9.898e-1130.77Fatty acyl-CoA reductase OS=Acinetobacter baylyi G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top