EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: ACR1_ACIAD (Fatty acyl-CoA reductase OS=Acinetobacter sp. (strain ADP1) GN=acr1 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 56/182 (30.77%), Postives = 87/182 (47.80%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAG--VSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSI 541
            TGASSG+G      +A AG  ++  AR  + L+ +   I +Q G +        D++A    I+   Q    +   +D L+NNAG  +  AV    D   + +   M+ N  G+  +   +   M    + G +INISSI   +        AY +SKA L+A ++CLS E+  HKI + SI
Sbjct:   29 TGASSGIGLTIAKRIAAAGAHVLLVARTQETLEEVKAAIEQQGGQASIFPCDLTDMNA----IDQLSQQIMASVDHVDFLINNAGRSIRRAVHESFDRFHD-FERTMQLNYFGAVRLVLNLLPHMIK-RKNGQIINISSIGVLANATRFS--AYVASKAALDAFSRCLSAEVLKHKISITSI 202          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: ABA2_ARATH (Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.898e-11
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV---AYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG ++G+G        K G ++     + D    +C  + +   S   A  +  DV      I N+V  A + FG +D L+NNAG+ GA    + + +  E+      N+ G++L  K+   R+    ++GS++++ S+     G + GGV   +Y  SK  +  +T+ ++ ELG H IRVN + P
Sbjct:   26 TGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGE-SKETAFFIHGDVRVEDD-ISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAA-RVMIPEKKGSIVSLCSV-----GGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSP 203          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
ACR1_ACIAD9.898e-1130.77Fatty acyl-CoA reductase OS=Acinetobacter sp. (str... [more]
ABA2_ARATH9.898e-1127.96Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top