EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2049_STAEQ (Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 54/192 (28.12%), Postives = 101/192 (52.60%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEG 577
            TGASSG+G      L++ G  IV   R   RL  +  ++N    +  + ++ ++ V +N   I++ ++   + FG ID +VN+AG S + K   D   E+W+ ++  N+ G+  V +     +   +  G +IN++S++     +      Y ++KA ++A+T+ L  EL    ++V SI PG+  + +TEG
Sbjct:   12 TGASSGIGEAIAKKLSQQGASIVLVGRNEQRLNEIAQQLN----TPAKVVSADVTVKSN---IDDMLKAVIDHFGHIDIVVNSAGQSLSSKIT-DYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSS-GHIINLASVSGFEPTKT--NAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEG 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2036_STAES (Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 54/192 (28.12%), Postives = 101/192 (52.60%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEG 577
            TGASSG+G      L++ G  IV   R   RL  +  ++N    +  + ++ ++ V +N   I++ ++   + FG ID +VN+AG S + K   D   E+W+ ++  N+ G+  V +     +   +  G +IN++S++     +      Y ++KA ++A+T+ L  EL    ++V SI PG+  + +TEG
Sbjct:   12 TGASSGIGEAIAKKLSQQGASIVLVGRNEQRLNEIAQQLN----TPAKVVSADVTVKSN---IDDMLKAVIDHFGHIDIVVNSAGQSLSSKIT-DYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSS-GHIINLASVSGFEPTKT--NAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPMTEG 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_PSEAE (3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa GN=fabG PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 54/193 (27.98%), Postives = 98/193 (50.78%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+G+   L+L + G  ++  A      + + + +     + V    + LDVS++  ++  +++   +  G+   +VNNAG++      + + ++EW  ++ TNL   + +SK V   M  A   G +INI S+         G   YA++KAGL   T+ L+ E+G   I VN++ PG   +++T  L
Sbjct:   11 TGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLK---ANGVEGAGLVLDVSSD-ESVAATLEHIQQHLGQPLIVVNNAGITRD-NLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARW-GRIINIGSVVGAMGNA--GQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTREL 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS7_HUMAN (Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 62/195 (31.79%), Postives = 100/195 (51.28%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRV---DRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHK-IRVNSICPGLFKSEITE 574
            TGASSG+G E    L+K G  +V +ARRV   +R+K  C E        +  + + LD++  G+  E + +   + FGRID LVNN G+S      +D + + +  +++ N  G+  ++K V   M +  Q G ++ ++SI       +P  + Y +SK  L      L  EL  +  I V++ICPG  +S I E
Sbjct:   56 TGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDI--LVLPLDLTDTGSH-EAATKAVLQEFGRIDILVNNGGMSQR-SLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQ-GKIVTVNSILGII--SVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVE 243          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHBA_BACSU (2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis GN=dhbA PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 64/192 (33.33%), Postives = 91/192 (47.40%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGV--SGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAA-TSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA+ G+G      LA  G  I A     ++L+ +   + K  G    A   ++    + AAI+          G ID LVN AGV   G + S   L++EEW      N TG +  S+ V   M D  + GS++ + S AA   R  +    AYASSKA     TKCL LEL  + IR N + PG  ++++
Sbjct:   14 TGAAQGIGEAVARTLASQGAHIAAVDYNPEKLEKVVSSL-KAEGRHAEAFPADV---RDSAAIDEITARIEREMGPIDILVNVAGVLRPGLIHS---LSDEEWEATFSVNSTGVFNASRSVSKYMMD-RRSGSIVTVGSNAAGVPRTSM---AAYASSKAAAVMFTKCLGLELAEYNIRCNIVSPGSTETDM 194          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YXBG_BACSU (Uncharacterized oxidoreductase yxbG OS=Bacillus subtilis GN=yxbG PE=3 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.130e-14
Identity = 63/197 (31.98%), Postives = 104/197 (52.79%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS---GAVKS-PLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGA++G+G+      A  G R++      D+++   D I K  G   +A +  LDVS   +    + Q+  +A G ID L NNAGV    G V   P+DL    ++ I+  +L G++L SKY+   M +    GS+IN SS++  +      G  Y ++K G+  +TK ++++   + IRVNSI PG  ++ + + L
Sbjct:   12 TGAATGIGQATAEVFANEGARVIIGDINKDQMEETVDAIRKNGG---QAESFHLDVSDENSVKAFADQIK-DACGTIDILFNNAGVDQEGGKVHEYPVDL----FDRIIAVDLRGTFLCSKYLIPLMLENG--GSIINTSSMSGRAADLDRSG--YNAAKGGITNLTKAMAIDYARNGIRVNSISPGTIETPLIDKL 196          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCDR_XANP2 (2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 1.130e-14
Identity = 60/216 (27.78%), Postives = 105/216 (48.61%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTE--EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGT 643
            TGASSG G          G R+ A     + L+            + + + V  DV+  G  +  ++    E FG ID LVNNAG++G  ++ +  T   E+++ +M  N+ G +L  + V   M      G ++NI+S+A  S    PG  AY +SK  +  +TK ++++     IR N++CPG+ ++ +T+  + +  L +      P ++ GT
Sbjct:    8 TGASSGNGLAIATRFLARGDRVAALDLSAETLEETAR--THWHAYADKVLRVRADVADEGD-VNAAIAATMEQFGAIDVLVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHML-LQGAGVIVNIASVA--SLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGT 217          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FOX2_YEAST (Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae GN=FOX2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.130e-14
Identity = 73/249 (29.32%), Postives = 115/249 (46.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVA---------AARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGA  GLG+ + L  A  G ++V          +         + DEI K  G +V   A    V+ NG   E  ++ A + FGR+D L+NNAG+   V S   +TE E+  ++  +LTG + +S+     MR + + G +IN +S A        G   Y+++K GL  + + L+ E   + I VNSI P L +S +TE ++    L  +                +  LV YL H+S+ +    F L
Sbjct:   15 TGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVDEIKKAGGIAV---ANYDSVNENG---EKIIETAIKEFGRVDVLINNAGILRDV-SFAKMTEREFASVVDVHLTGGYKLSRAAWPYMR-SQKFGRIINTASPAGLFGNF--GQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAP-LARSRMTENVLPPHILKQLGPE------------KIVPLVLYLTHESTKVSNSIFEL 240          

HSP 2 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 67/214 (31.31%), Postives = 107/214 (50.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLK---SLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNN--VASRTYPL 628
            TGA  GLG+   +  A+ G ++V     V+ +K   S+ +EINK  G    A+    DV      I   +Q A   F R+D LVNNAG+    KS L + +EEW  ++K +L  ++ +SK V   +    + G +IN +S +        G   YA++KA +   +K ++LE     I VN I P   ++ +T+ +  +  L+N   AS+  PL
Sbjct:  328 TGAGGGLGKSHAIWFARYGAKVV-----VNDIKDPFSVVEEINKLYGEGT-AIPDSHDVVTEAPLI---IQTAISKFQRVDILVNNAGIL-RDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVW-PIFTKQKSGFIINTTSTSGIYGNF--GQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAPHA-ETAMTKTIFSEKELSNHFDASQVSPL 527          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: NODG_RHIS3 (Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.476e-14
Identity = 66/238 (27.73%), Postives = 111/238 (46.64%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL--DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G      L   G  +     RV++L++L  E+    G  V+     L   +N   ++   Q A      +D LVNNAG++   K  L   +++ +W+ +++ NLT  + +++ +   M    + G +INI+S+   +    PG   Y +SKAG+   +K L+ E+    I VN + PG  +S +T+ L  K           P R  GT+   + S V YL  + +    G
Sbjct:   12 TGASGGIGEAIARVLHAQGAIVGLHGTRVEKLETLAAEL----GDRVKLFPANL---SNRDEVKALGQKAEADLEGVDILVNNAGIT---KDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMM-RRRHGRIINITSVVGVTGN--PGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAMTDKLNDKQ--KEAIMAAIPTRRMGTS-VEVASAVAYLASNEAAYVTG 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_BOVIN (Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.476e-14
Identity = 64/236 (27.12%), Postives = 108/236 (45.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+   +      + K  G SV      +  + +    E  V  A +  G +D L++NA VS    S +D+ EE W+ I+  N+  + L++K V   M      GS++ +SSIAA S    P    Y  SK  L  +TK L+LEL    +RVN + PGL ++  +  L +          T+ ++  G  +     +V +L  + +    G
Sbjct:   20 TASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATL-KGEGLSVTGTVCHVGKAEDR---ERLVATAVKLHGGVDILISNAAVSPFFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRGG-GSIVIVSSIAAYS--PFPSLGPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSFSRVLWEDPARQESIKATFQIKRIGKPEEC-AGIVSFLCSEDASYITG 247          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
Y2049_STAEQ8.651e-1528.13Uncharacterized oxidoreductase SERP2049 OS=Staphyl... [more]
Y2036_STAES8.651e-1528.13Uncharacterized oxidoreductase SE_2036 OS=Staphylo... [more]
FABG_PSEAE8.651e-1527.983-oxoacyl-[acyl-carrier-protein] reductase OS=Pseu... [more]
DHRS7_HUMAN8.651e-1531.79Dehydrogenase/reductase SDR family member 7 OS=Hom... [more]
DHBA_BACSU8.651e-1533.332,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS... [more]
YXBG_BACSU1.130e-1431.98Uncharacterized oxidoreductase yxbG OS=Bacillus su... [more]
HCDR_XANP21.130e-1427.782-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobac... [more]
FOX2_YEAST1.130e-1429.32Peroxisomal hydratase-dehydrogenase-epimerase OS=S... [more]
NODG_RHIS31.476e-1427.73Nodulation protein G OS=Rhizobium sp. (strain N33)... [more]
DHRS4_BOVIN1.476e-1427.12Dehydrogenase/reductase SDR family member 4 OS=Bos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top