EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MTDH_AGABI (NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 1.249e-13
Identity = 65/243 (26.75%), Postives = 111/243 (45.68%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAAT--SRGQLPGG---VAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTF 715
            TG + G+G  F   +A AG  +    R       + +++ K+ G  V+  A + DVS N   +  ++Q      G I  L+ NAGVS  VK   +LT E++  +   N+ G +   + V        Q+GS++  SS+++   ++  L G    V Y SSKA  + + K L+ E     IRVN++ PG   ++ T  + KK  + +  +   PL  F   +      +  L   ++ M  G +
Sbjct:   17 TGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFG--VKTKAYQCDVS-NTDIVTKTIQQIDADLGAISGLIANAGVS-VVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKK--IRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEY 253          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DECR_HUMAN (2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=DECR1 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.249e-13
Identity = 69/244 (28.28%), Postives = 123/244 (50.41%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSI-AATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE------ITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG  +GLG+     L+  G + V A+R++D LK+  ++I+ Q+G+ V   A++ DV  +   ++N+V    +  G  + ++NNA  +G   SP + L+   W  I    L G+  V+  +  ++  A +  + ++I++I A T  G +   V  AS+KAG+ AM+K L+ E G + +R N I PG  K++         G  +K+ +  +     P    GT +  L +L  +L  D +    G
Sbjct:   65 TGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVH--AIQCDV-RDPDMVQNTVSELIKVAGHPNIVINNA--AGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFV---VPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRI-----PCGRLGTVE-ELANLAAFLCSDYASWING 294          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2778_STAA8 (Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 51/190 (26.84%), Postives = 100/190 (52.63%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA SG+G      L + G ++V A R  ++L+++ +++++ S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   ++     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDS-----VKVVPTDVT-NKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAQAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT 191          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2488_STAAC (Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 51/190 (26.84%), Postives = 100/190 (52.63%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA SG+G      L + G ++V A R  ++L+++ +++++ S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   ++     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDS-----VKVVPTDVT-NKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAQAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT 191          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2478_STAAM (Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 53/197 (26.90%), Postives = 100/197 (50.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA SG+G      L + G ++V A R  D+L+++ +++ + S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   ++     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT      D
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKDKLQNVANQLAQDS-----VKVVPTDVT-NKEEVDELMKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAQAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPSD 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2422_STAA3 (Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 51/190 (26.84%), Postives = 100/190 (52.63%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA SG+G      L + G ++V A R  ++L+++ +++++ S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   ++     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDS-----VKVVPTDVT-NKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAQAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT 191          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2266_STAAN (Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 53/197 (26.90%), Postives = 100/197 (50.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA SG+G      L + G ++V A R  D+L+++ +++ + S        V  DV+ N   ++  +++A + FG +D ++N+AG   + K   D   +EW+ ++  N+ G+   ++     M +    G +INI+SI+            Y+++KA ++ +T+ L  EL    ++V SI PG+  + IT      D
Sbjct:   12 TGAGSGIGEAIATLLHEEGAKVVLAGRNKDKLQNVANQLAQDS-----VKVVPTDVT-NKEEVDELMKIAQQTFGGLDIVINSAGQMLSSKI-TDYQVDEWDSMIDVNIKGTLYTAQAALPTMLE-QSSGHLINIASISGFE--VTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPSD 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MOMAS_ORYSJ (Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 61/198 (30.81%), Postives = 98/198 (49.49%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TG +SG+G        K G R+V A  + +   SL  E+   + S V       DV+  G  +  +V  A   FG++D + NNAGVSG     + + T+E++  ++  NL G +L +K+    M  A + GS+I+ +S++++  G      AY +SK  L   T+  + ELG H IRVN + P    + +    M  D
Sbjct:   23 TGGASGIGACTARLFVKHGARVVVADIQDELGASLVAELGPDASSYVHC-----DVTNEGD-VAAAVDHAVARFGKLDVMFNNAGVSGPPCFRMSECTKEDFERVLAVNLVGPFLGTKHAARVMAPARR-GSIISTASLSSSVSGA--ASHAYTTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLARAAMGMD 211          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BUTA_STAES (Acetoin(diacetyl) reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.632e-13
Identity = 65/202 (32.18%), Postives = 100/202 (49.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQ-SGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE----ITEGLMKKD 592
            TGA+ GLG+     LA  G  IV      D  ++L  E  K+      +A+A + DVS      E  VQ A   FG++D +VNNAGV  AV   L++ EEE + +   N+ G+    +    +      +G +IN  SIA     ++ G   Y+++K  + + T+  + EL    I VN+ CPG+ K+E    I E ++K D
Sbjct:    8 TGAAGGLGKGIAERLANDGFNIVLQ----DINEALLLETEKEFKEKGYQAVAYKSDVSKKKEQ-EELVQFAVTEFGQLDVMVNNAGVD-AVTPILEIGEEELSKLFNINVFGTLFGIQAAANQFIKQKSKGKIINACSIAGHESYEVLG--TYSATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWDRIDEEMVKLD 201          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_XENLA (Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.210e-13
Identity = 66/226 (29.20%), Postives = 107/226 (47.35%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAF----GRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLV 670
            G S G+G+     LA+   ++   +R ++  ++   EI          +A+  DVS      EN +Q  ++      G ID LVN+AG+S      L    E+   ++  NL G+    K V ++     Q GS++NI SI    +G + G   Y +SK GL   +K L+ E+    IRVN + PG  ++++T  L K+D LN    +  PL  FG  +    S++
Sbjct:    9 GGSRGIGKAVAKLLAQKDYKVAVISRNLEVAQAAVTEIGAH-------LALSCDVSK-----ENEIQCTFKEIKNNLGNIDYLVNSAGISRDALL-LRTRSEDIMSLLSINLVGTIQTCK-VALKGMIQQQGGSIVNIGSIVG-HKGNI-GQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIRTDMTSDL-KEDSLN----KMIPLGRFGEPEEVAQSVL 213          

HSP 2 Score: 22.7126 bits (47), Expect = 2.210e-13
Identity = 6/12 (50.00%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  697 YVSGHIFIVDSG 732
            Y++GH+ +VD G
Sbjct:  220 YITGHVLVVDGG 231          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
MTDH_AGABI1.249e-1326.75NADP-dependent mannitol dehydrogenase OS=Agaricus ... [more]
DECR_HUMAN1.249e-1328.282,4-dienoyl-CoA reductase, mitochondrial OS=Homo s... [more]
Y2778_STAA81.632e-1326.84Uncharacterized oxidoreductase SAOUHSC_02778 OS=St... [more]
Y2488_STAAC1.632e-1326.84Uncharacterized oxidoreductase SACOL2488 OS=Staphy... [more]
Y2478_STAAM1.632e-1326.90Uncharacterized oxidoreductase SAV2478 OS=Staphylo... [more]
Y2422_STAA31.632e-1326.84Uncharacterized oxidoreductase SAUSA300_2422 OS=St... [more]
Y2266_STAAN1.632e-1326.90Uncharacterized oxidoreductase SA2266 OS=Staphyloc... [more]
MOMAS_ORYSJ1.632e-1330.81Momilactone A synthase OS=Oryza sativa subsp. japo... [more]
BUTA_STAES1.632e-1332.18Acetoin(diacetyl) reductase OS=Staphylococcus epid... [more]
CBR4_XENLA2.210e-1329.20Carbonyl reductase family member 4 OS=Xenopus laev... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top