EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FIXR_BRAJA (Protein fixR OS=Bradyrhizobium japonicum GN=fixR PE=3 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 72/243 (29.63%), Postives = 118/243 (48.56%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARR-VDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGR-IDALVNNAGVS-----GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G       ++AG RI++ AR+  D  +   +  N            ++D+  +        ++     G  + ALVNNAGVS     G   + L  + + W  +   NL    L+++ +   +R A+  GS++N++SIA  SR     G AYA+SKA L ++T+ L+ +   H IRVN+I PG    EI   ++  D    V + + PLR  GT D  +  ++ +L  D++    G
Sbjct:   42 TGASRGIGHATAKLFSEAGWRIISCARQPFDGERCPWEAGNDDH--------FQVDLGDHRMLPRAITEVKKRLAGAPLHALVNNAGVSPKTPTGDRMTSLTTSTDTWMRVFHLNLVAPILLAQGLFDELRAAS--GSIVNVTSIAG-SRVHPFAGSAYATSKAALASLTRELAHDYAPHGIRVNAIAPG----EIRTDMLSPDAEARVVA-SIPLRRVGTPD-EVAKVIFFLCSDAASYVTG 267          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_MOUSE (Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 59/200 (29.50%), Postives = 95/200 (47.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQS-GSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA+SGLGRE       AG ++V   R V  L+ L  E+   S G + +   V  D++  G     + ++  + FG +D L+NNAG+S  G +    D   +    +M+ N  G   ++K +   M +  Q G ++ ISSI    +  +P   AY++SK    A   CL  E+    I+V  I PG   + ++   +  D
Sbjct:   58 TGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLADPGTIAAAAAEIL-QCFGYVDVLINNAGISYRGTIS---DTIVDVDRKVMEINYFGPVALTKALLPSMVERKQ-GHIVAISSI--QGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTAD 250          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_MOUSE (Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 59/236 (25.00%), Postives = 107/236 (45.34%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+   +      +  + G SV  +   +  + +    E  +  A +    ID LV+NA V+    + +D+TEE W+ ++  N+T + ++ K V   M +    GSV+ + S+A  +R   P    Y  SK  L  +TK  + EL    IRVN + PGL K+  +  L ++    +       +R  G  +     +V +L  + +    G
Sbjct:   20 TASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGE-GLSVTGIVCHVGKAEDR---EKLITTALKRHRGIDILVSNAAVNPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEM-EKRGGGSVVIVGSVAGFTR--FPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRFSSVLWEEKAREDFIKEAMQIRRLGKPEDC-AGIVSFLCSEDASYING 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BUDC_KLEPN (Acetoin(diacetyl) reductase OS=Klebsiella pneumoniae GN=budC PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.804e-12
Identity = 58/188 (30.85%), Postives = 88/188 (46.81%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKS 562
            TGA  G+G+   L L K G  +  A       K++  EIN+  G   RAMAV++DVS        +V+ A +  G  D +VNNAGV  A  +P++ +T E  + +   N+ G     +      +     G +IN  S A       P    Y+SSK  +  +T+  + +L    I VN  CPG+ K+
Sbjct:    8 TGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGG---RAMAVKVDVSDRDQVFA-AVEQARKTLGGFDVIVNNAGV--APSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGN--PELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKT 187          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDUD_BACSU (2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis GN=kduD PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.319e-12
Identity = 62/236 (26.27%), Postives = 109/236 (46.19%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG  +G+G+     LA AG  I+  +      ++   ++ +Q G    +  +++   +   AI++S    +E   +ID LVNNAG+    K+  D  EE W H++  NL   +++++     M      G +INI+S+ +   G L    AY +SK  +  +TK  + E     I+VN+I PG   +  T+ +   +  N    +  P   +G  D    + V +L   +SD   G
Sbjct:   18 TGPGTGIGQGIAKALAGAGADIIGTSHTSSLSET--QQLVEQEGRIFTSFTLDM---SKPEAIKDSAAELFEN-RQIDILVNNAGIIHREKAE-DFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGH-GKIINIASLLSFQGGILVP--AYTASKHAVAGLTKSFANEWAASGIQVNAIAPGYISTANTKPIRDDEKRNEDILKRIPAGRWGQADDIGGTAV-FLASRASDYVNG 242          

HSP 2 Score: 21.9422 bits (45), Expect = 2.319e-12
Identity = 8/12 (66.67%), Postives = 9/12 (75.00%), Query Frame = 1
Query:  697 YVSGHIFIVDSG 732
            YV+GHI  VD G
Sbjct:  239 YVNGHILAVDGG 250          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_ECOL6 (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Escherichia coli O6 GN=ydfG PE=3 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.356e-12
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL----------FKSEITEGLMKKDWLNNVA 610
            TGA++G G        + G +++A  RR +RL+ L DE+             +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N  G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL          FK +  +G  +K + N VA
Sbjct:    6 TGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDN------LYIAQLDVR-NRAAIEEMLASLPAEWSNIDILVNNAGLALGMEPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERN-HGHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGD--DGKAEKTYQNTVA 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y0419_STAS1 (Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.356e-12
Identity = 58/195 (29.74%), Postives = 94/195 (48.21%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAG--VSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIA---ATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGASSG+G      LA  G ++V   R   RL  +   I     + V    V++    +   +   V+   E FG+ID LVN+AG  +S A+    +   E W  ++  N+ G+      V   M +    G +INI+SI+    T +  L     Y++SKA ++++T+ L  EL    +RV SI PG+  + ++
Sbjct:   12 TGASSGIGASIAETLANQGVKVVLTGRDESRLAEVAKRIQDNKQAVVETSIVDV---THKEEVTELVEKTKEKFGQIDILVNSAGLMLSSAI---TEGDVEAWEAMIDVNIKGTLYTINAVLPSMLN-QSSGHIINIASISGFEVTKKSTL-----YSASKAAVHSITQGLEKELAKTGVRVTSISPGMVDTPLS 194          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHAB_PARDE (Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.356e-12
Identity = 61/197 (30.96%), Postives = 96/197 (48.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TG S G+G      L +AG  + A  A   D  ++  +E   ++    +    + D  A G      ++   E  G I  LVNNAG++        +T ++W  ++ TNLTG + ++  V   MRD  + G ++NISSI    +GQ  G   Y+++KAG    TK L+ E     I VN+ICPG   +E+   + +K
Sbjct:    8 TGGSRGIGAAISKALKEAGYTVAANYAGNDDAARAFTEETGIKT---YKWSVADYDACAAG------IKQVEEELGPIAVLVNNAGITRDAMFH-KMTPQQWKEVIDTNLTGLFNMTHPVWSGMRD-RKYGRIVNISSING-QKGQA-GQANYSAAKAGDLGFTKALAQEGARAGITVNAICPGYIGTEMVRAIDEK 191          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_ASPTN (3-ketoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.356e-12
Identity = 63/196 (32.14%), Postives = 95/196 (48.47%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRID--ALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L DE+  +   SV+   + +D + N    ++  Q   E  G +D   L+NN G S  +  P  LT EEE   I+  N  G+  V++ V   M    + G ++ + S      G LP  +   Y+ SKA L   +  L  EL  + I V  +   L  S +++
Sbjct:   80 TGASDGLGKEFALQLARAGYNIVLVSRTASKLDTLSDELTSKY-PSVQTKVLAMDFARNQ---DSDYQKLKELIGDLDVAVLINNVGKSHDMPVPFALTSEEEMTDIVTINCMGTLRVTQLVVPGMMQ-RRRGLILTMGSFG----GLLPTPLLATYSGSKAFLQQWSTSLGSELAPYGITVELVQAYLITSAMSK 266          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YAY8_SCHPO (Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe GN=SPAC4H3.08 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 55/198 (27.78%), Postives = 94/198 (47.47%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKS-LCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TG  SG+G+   +  A+ G  +V +    +R  + +  ++ ++ G +      +LD S N     + V  A +  G ID LVNN       +S  D+ +E+W+   KTN+   + V+K     M+  +   S++N SSI A      P  + Y S+K  + A T+ LS +   H IRVN++ PG   + +      K+
Sbjct:   48 TGGDSGIGKAAAVMFAREGSDLVISCLPEERDDAEVTRDLIEREGRNCWIWEGKLDKSDN---CRDLVDFALKKLGWIDVLVNNIAYQQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKSGS---SIVNCSSINAYV--GRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLVSSTFPKE 237          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
FIXR_BRAJA1.381e-1229.63Protein fixR OS=Bradyrhizobium japonicum GN=fixR P... [more]
DRS7B_MOUSE1.381e-1229.50Dehydrogenase/reductase SDR family member 7B OS=Mu... [more]
DHRS4_MOUSE1.381e-1225.00Dehydrogenase/reductase SDR family member 4 OS=Mus... [more]
BUDC_KLEPN1.804e-1230.85Acetoin(diacetyl) reductase OS=Klebsiella pneumoni... [more]
KDUD_BACSU2.319e-1226.272-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=B... [more]
YDFG_ECOL62.356e-1230.05NADP-dependent L-serine/L-allo-threonine dehydroge... [more]
Y0419_STAS12.356e-1229.74Uncharacterized oxidoreductase SSP0419 OS=Staphylo... [more]
PHAB_PARDE2.356e-1230.96Acetoacetyl-CoA reductase OS=Paracoccus denitrific... [more]
MKAR_ASPTN2.356e-1232.143-ketoacyl-CoA reductase OS=Aspergillus terreus (s... [more]
YAY8_SCHPO3.077e-1227.78Uncharacterized oxidoreductase C4H3.08 OS=Schizosa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top