EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS7_MOUSE (Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 6.200e-13
Identity = 63/205 (30.73%), Postives = 104/205 (50.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARR---VDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSG---AVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHK-IRVNSICPGLFKSEITEGLMKKD 592
            TGASSG+G E    L+K G  +V +ARR   ++R+K  C E        +  + ++L D S++ AA +  +Q     FG+ID LVNN G S     +++ LD+ +E    ++  N  G+  ++K V   M +  Q G ++ ++SIA  +   L  G  Y +SK  L      L  ELG +  I   ++ PG  +S+I +    ++
Sbjct:   56 TGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNLKEKDILVLPLDLTDTSSHEAATKAVLQ----EFGKIDILVNNGGRSQRSLVLETNLDVFKE----LINLNYIGTVSLTKCVLPHMIERKQ-GKIVTVNSIAGIASVSLSSG--YCASKHALRGFFNALHSELGQYPGITFCNVYPGPVQSDIVKNAFTEE 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_SALTY (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Salmonella typhimurium GN=ydfG PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.097e-13
Identity = 57/184 (30.98%), Postives = 93/184 (50.54%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL 553
            TGA++G G        + G +++A  RR +RL++L DE+ +        +  +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N+ G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL
Sbjct:    6 TGATAGFGECIARRFVENGHKVIATGRRHERLQALKDELGEN------VLTAQLDVR-NRAAIEEMMASLPAQWRDIDVLVNNAGLALGLEPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNR-GHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGL 179          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_SALTI (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Salmonella typhi GN=ydfG PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.097e-13
Identity = 57/184 (30.98%), Postives = 93/184 (50.54%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL 553
            TGA++G G        + G +++A  RR +RL++L DE+ +        +  +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N+ G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL
Sbjct:    6 TGATAGFGECIARRFVENGHKVIATGRRHERLQALKDELGEN------VLTAQLDVR-NRAAIEEMMASLPAQWRDIDVLVNNAGLALGLEPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNR-GHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGL 179          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDSR_MOUSE (3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.097e-13
Identity = 57/185 (30.81%), Postives = 92/185 (49.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRA-MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP--GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG SSG+G+   ++  K G  I   AR  D+L     +I K S +  +  + + +DVS +   +EN ++ A E  G +D LVN AG S + K   +L    +  +M  N  GS   S+ V   M++  + G ++ +SS A    GQL   G  AY+SSK  +  + + L +E+  + + V    P
Sbjct:   38 TGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFE-ELEVSSFEKLMSINYLGSVYPSRAVITTMKE-RRVGRIVFVSSQA----GQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYP 216          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_SHIFL (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Shigella flexneri GN=ydfG PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.058e-12
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL----------FKSEITEGLMKKDWLNNVA 610
            TGA++G G        + G +++A  RR +RL+ L DE+             +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N  G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL          FK +  +G  +K + N VA
Sbjct:    6 TGATAGFGECITRRFIQQGHKVIATGRRQERLQELTDELGDN------LYIAQLDVR-NRAAIEEMLASLPAEWSNIDILVNNAGLALGMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERN-HGHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTTVRVTDIEPGLVGGTEFSNVRFKGD--DGKAEKTYQNTVA 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: RHLG_PSEAE (Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa GN=rhlG PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.058e-12
Identity = 64/217 (29.49%), Postives = 98/217 (45.16%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS-GAVKSPLDLTEEEWNHIMKTNLTGSW-LVSKYVCIRMRDANQEGS--VINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            TG S G+G+     L +AG R+   AR  +     C +   +  +     A+  D+S+   A     Q   E   R+D LVNNAG S GA      ++   W  +M+ N+T  +  + + + +  R A+ E    VINI S+A  S        AY  SKA L+ +++ L+ EL    I VN I PG F S +T  +          S + P+  +G
Sbjct:   15 TGGSRGIGQMIAQGLLEAGARVFICARDAEA----CADTATRLSAYGDCQAIPADLSSEAGA-RRLAQALGELSARLDILVNNAGTSWGAALESYPVSG--WEKVMQLNVTSVFSCIQQLLPLLRRSASAENPARVINIGSVAGIS-AMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQALEADSASIPMGRWG 223          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_MOUSE (Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 1.058e-12
Identity = 62/214 (28.97%), Postives = 104/214 (48.60%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTT 646
            G S G+GR     +A+ G R+   +R ++  K    E+          +A   DV A    ++++ Q   +  G ++ LVN AG++         TE+  + +  TNL GS L  K     M    Q GS++N+ SI    +G + G  AY+++K GL   ++ L+ E+   KIRVN + PG  ++++T  L ++ +  N+     PL  FG T
Sbjct:    9 GGSRGIGRAVAQLMAQKGYRLAIVSRNLEVAKVTAGELGGNH------LAFRCDV-AKEQDVQSTFQEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQL-HTNLLGSMLTCKAAMKTM--IQQGGSIVNVGSIIGL-KGNV-GQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLKEEHFKKNI-----PLGRFGET 205          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: VER1_ASPPA (Versicolorin reductase OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 53/192 (27.60%), Postives = 100/192 (52.08%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA  G+G    + L + G ++V   A   +  + + ++I K +G+   A+A++ DV    A  +   +     FG +D + +NAG+   G +K   D+T EE++ + + N  G + V++     MR+    G +I  SS  A  +G +P    Y+ SK  ++   +C++++ G  KI VN++ PG  K+++
Sbjct:   15 TGAGRGIGAAIAVALGERGAKVVVNYAHSREAAEKVVEQI-KANGTD--AIAIQADVGDPEATAKLMAETV-RHFGYLDIVSSNAGIVSFGHLK---DVTPEEFDRVFRVNTRGQFFVAREAYRHMREG---GRIILTSSNTACVKG-VPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDM 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: TRN2_DATST (Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 64/240 (26.67%), Postives = 112/240 (46.67%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLM----KKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG S G+G     +LA  G  +   +R    L   C    +  G  V A   +L   +    + N+V  A    G+++ LVNNAG+    K   D T E+++ IM  N   ++ +S      ++ A++ G+V+ ISS++      +P    Y ++K  ++ +T+CL+ E     IRVN + PG+  + + E  +    +K+ LN +  R   LR  G     L ++V +L   ++    G
Sbjct:   15 TGGSRGIGYGIVEELASLGASVYTCSRNQKELND-CLTQWRSKGFKVEASVCDLSSRSERQELMNTV--ANHFHGKLNILVNNAGIV-IYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLK-ASERGNVVFISSVSGALA--VPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKENLNKLIDRC-ALRRMG-EPKELAAMVAFLCFPAASYVTG 245          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: LINX_PSEPA (2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Pseudomonas paucimobilis GN=linX PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.381e-12
Identity = 60/195 (30.77%), Postives = 92/195 (47.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEE---WNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP--GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TG +SGLG       A+ G ++V      +  K +  EI    G    A+ + LDV+ + A+  N++  A + FG +  L N AG+      P    EE    WN ++  N T  +L  K     +  +   GS+INISS+     G  P  G  +Y ++KA +  M+K  +LE     +RVN+I PG   + IT
Sbjct:   13 TGGASGLGAAQAKRFAEEGAKVVIGDLNEEMAKGVVAEIRAAGGD---ALFIRLDVT-DAASWNNAIAAAVDGFGGLTTLSNTAGII----HPGGFEEESIEGWNKMVAVNQTAIFLGIKAAIPELVKSGN-GSIINISSLI----GMFPTAGNASYCATKAAVRIMSKAAALEFVDRGVRVNTIVPGGMNTPIT 194          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DHRS7_MOUSE6.200e-1330.73Dehydrogenase/reductase SDR family member 7 OS=Mus... [more]
YDFG_SALTY8.097e-1330.98NADP-dependent L-serine/L-allo-threonine dehydroge... [more]
YDFG_SALTI8.097e-1330.98NADP-dependent L-serine/L-allo-threonine dehydroge... [more]
KDSR_MOUSE8.097e-1330.813-ketodihydrosphingosine reductase OS=Mus musculus... [more]
YDFG_SHIFL1.058e-1230.05NADP-dependent L-serine/L-allo-threonine dehydroge... [more]
RHLG_PSEAE1.058e-1229.49Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-... [more]
CBR4_MOUSE1.058e-1228.97Carbonyl reductase family member 4 OS=Mus musculus... [more]
VER1_ASPPA1.381e-1227.60Versicolorin reductase OS=Aspergillus parasiticus ... [more]
TRN2_DATST1.381e-1226.67Tropinone reductase 2 OS=Datura stramonium GN=TR2 ... [more]
LINX_PSEPA1.381e-1230.772,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydroge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top