EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y4VI_RHISN (Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 65/238 (27.31%), Postives = 111/238 (46.64%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLN-NVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA+ G+GR   +D+  A   +V A   VD   S   E+ +  G     + +E+DVS     +     +  + F RI+ LVNNAG+   + +  D   E++   +  NL G++ V+   C   +      +++N++S+A       P   AYA+SKAGL ++TK L+       IRV ++ PG  ++ +   L +   L+ +   R  PL      D  +   VR+L    +    G+
Sbjct:   15 TGAAGGIGRAL-VDIFAANGDVVVA---VDLPDSGVIELGQNLGEP--HLGLEVDVSREDDVVALRALLE-KRFSRIEVLVNNAGIGPTMAATADTALEDFQRALAINLVGAYSVA---CETAKLMKPGAAIVNVASLAGLLGN--PKRSAYAASKAGLISITKSLACRWASRGIRVTAVAPGHVRTPMVAELERAGKLDVSAIRRRVPLGRIARPD-EIARAVRFLASAQASYITGS 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: LINC_PSEPA (2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Pseudomonas paucimobilis GN=linC PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 60/244 (24.59%), Postives = 108/244 (44.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSV------RAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD-WLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG  SG+GR     L  +G  +  A            +IN ++G +V      +A     D+ A    ++  V     AFG +D   NNA +  A     +++ E +   M  N+TG++L  KY  + M +   +GS++N +S A      + G   Y  +K  +  +T+  + + G H IRVN++ PG  ++ + +  M  D  L    +  +P+  F        + V +L+ D++    G+
Sbjct:   12 TGGGSGIGRATVELLVASGANVPVA------------DINDEAGEAVVATSGGKAAYFRCDI-AQEEDVKALVAQTLAAFGGLDGSFNNAAIPQAGLPLAEVSLERFRQSMDINVTGTFLCMKYQILAMIERGTKGSIVNTASAAGVVGVPMHG--EYVGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAGLEPYLNSIHPIGRFSEPHEQAQAAV-WLLSDAASFVTGS 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDSR_HUMAN (3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 55/185 (29.73%), Postives = 92/185 (49.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRA-MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP--GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG SSG+G+   ++  K G  I   AR  D+L     EI   S +  +  + + +DVS +   +EN ++ A E  G +D LVN AG++ + K   DL    +  +M  N  GS   S+ V   M++  + G ++ +SS A    GQL   G  AY++SK  +  + + L +E+  + + +    P
Sbjct:   38 TGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFE-DLEVSTFERLMSINYLGSVYPSRAVITTMKE-RRVGRIVFVSSQA----GQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYP 216          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FOX2_CANTR (Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 53/182 (29.12%), Postives = 97/182 (53.30%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TGA +GLG+E+    AK G ++V     V+  K     +++   +   A   + DV+ +  AI  +V    + +G ID LVNNAG+    +S   ++++EW+ + + +L G++ +S+       +  Q G +INI+S +        G   Y+SSKAG+  ++K +++E   + I+VN + P
Sbjct:  328 TGAGAGLGKEYAKWFAKYGAKVV-----VNDFKDATKTVDEIKAAGGEAWPDQHDVAKDSEAIIKNVI---DKYGTIDILVNNAGILRD-RSFAKMSKQEWDSVQQVHLIGTFNLSRLAWPYFVE-KQFGRIINITSTSGIYGNF--GQANYSSSKAGILGLSKTMAIEGAKNNIKVNIVAP 497          

HSP 2 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 57/212 (26.89%), Postives = 100/212 (47.17%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAI----------ENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNV 607
            TGA  GLG+ + L+ AK G ++V        +  L   +N Q G+S  A  V  ++  NG             +  V+ A + FG +  ++NNAG+     S   +TE+++  ++  +L G++ V+K      +   + G ++N SS A        G   YAS+K+ L    + L+ E   + I+ N+I P L +S +TE ++    L  +
Sbjct:   14 TGAGGGLGKYYSLEFAKLGAKVV--------VNDLGGALNGQGGNSKAADVVVDEIVKNGGVAVADYNNVLDGDKIVETAVKNFGTVHVIINNAGILRDA-SMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQ-KQKYGRIVNTSSPAGLYGNF--GQANYASAKSALLGFAETLAKEGAKYNIKANAIAP-LARSRMTESILPPPMLEKL 212          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS1_MOUSE (Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.077e-12
Identity = 64/209 (30.62%), Postives = 91/209 (43.54%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNN--AGVSGAV----KSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG------VAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGAS G+GR   L L KAG  +    R +D L++   E     G   R + V  D S          Q+  E  GR+D LVNN  AGV   +    KS  ++    W+ I    L G +L S Y    M  A  +G ++ +SS         PGG      V Y   KA  + +    + EL  H +   S+ PGL ++E+ +  M K+
Sbjct:   13 TGASRGIGRGIALQLCKAGATVYITGRHLDTLRATAQEAQSLGG---RCVPVVCDSSQESEVKSLFEQVDREQKGRLDVLVNNAYAGVQAILNTTNKSFWEVPASIWDDINNVGLRGHYLCSVYGARLMVPAG-KGLIVIVSS---------PGGLQHMFNVPYGVGKAACDRLAADCAHELRRHGVSYVSLWPGLVQTEMVKEFMAKE 208          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_ECOLI (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.019e-12
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL----------FKSEITEGLMKKDWLNNVA 610
            TGA++G G        + G +++A  RR +RL+ L DE+             +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N  G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL          FK +  +G  +K + N VA
Sbjct:    6 TGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDN------LYIAQLDVR-NRAAIEEMLASLPAEWCNIDILVNNAGLALGMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERN-HGHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGD--DGKAEKTYQNTVA 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_RAT (Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.019e-12
Identity = 58/202 (28.71%), Postives = 95/202 (47.03%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEI---NKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA+SGLG+E       AG ++V   R V  L+    E+   +   G + +   V  D++  GA    + ++  + FG +D L+NNAG+S  GA+    D   +    +M+ N  G   ++K +   M +  + G ++ ISSI    +  +P   AYA+SK    A   CL  E+    I V  I PG   + ++   +  D
Sbjct:   58 TGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLADPGAIAPAAAEIL-QCFGYVDILINNAGISYRGAIS---DTIVDVDRKVMEINYFGPVALTKALLPSMVE-RKRGHIVAISSI--QGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNAVTAD 252          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_XENTR (Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 5.093e-12
Identity = 60/222 (27.03%), Postives = 105/222 (47.30%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLV 670
            G S G+G+     LA+   ++   +R ++  K+   E+          +A+  DVS     I+++ +      G +D LVN+AG+       L    E+   ++  NL G+    K + +R     Q G+++NI SI    +G + G   Y +SK GL   +K L+ E+    IRVN + PG   +++T GL ++D L    ++  PL  FG  +    S++
Sbjct:    9 GGSRGIGKAVSKLLAQRDYKVAVISRDLEVAKAAAAEVGAH-------LALSCDVSKENE-IQDTFKEITNNLGNVDYLVNSAGIRRDALL-LRTRSEDIRSLLSVNLVGTIQTCK-LALRSMIQQQGGAIVNIGSIVG-HKGNI-GQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTLGL-EEDSL----TKMVPLGRFGDPEEVAQSVL 213          

HSP 2 Score: 22.7126 bits (47), Expect = 5.093e-12
Identity = 6/12 (50.00%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  697 YVSGHIFIVDSG 732
            Y++GH+ +VD G
Sbjct:  220 YITGHVLVVDGG 231          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YTKK_BACSU (Putative oxidoreductase ytkK OS=Bacillus subtilis GN=ytkK PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.249e-12
Identity = 65/242 (26.86%), Postives = 110/242 (45.45%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARR----VDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            T  S GLGR+    L   G  +    R+    V RLK  C +         R   V+ DV+     +  + + A   FGRID L+NNAG     +  L D T++EW  +++ NL+  + + K V   MR   Q G +I      A          A+ ++K GL ++TK +++E     I  N +CPG    ++ E  +++  +  +     P+   GT +  +  ++ +L  ++SD+  GT
Sbjct:    7 TAGSKGLGRKVTETLLAKGYSVTVNYRQDEEAVSRLKEACPDCLD------RLQFVKGDVTKKEDLLRIA-EAALNRFGRIDFLINNAGPYIFERKKLADYTDDEWYGMLEGNLSAVFHLFKAVIPIMRK-QQFGRIITYGFQGAAHAPGWLHRSAFGAAKVGLASLTKTIAIEEAEFGITANMVCPGDIVGDMKEASIEEARM-RIGKEKTPIGRSGTGED-IARIIAFLCEENSDLVTGT 238          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YDFG_ECO57 (NADP-dependent L-serine/L-allo-threonine dehydrogenase ydfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.249e-12
Identity = 64/213 (30.05%), Postives = 100/213 (46.95%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGL----------FKSEITEGLMKKDWLNNVA 610
            TGA++G G        + G +++A  RR +RL+ L DE+             +LDV  N AAIE  +      +  ID LVNNAG++  ++     + E+W  ++ TN  G   +++ V   M + N  G +INI S A +      GG  Y ++KA +   +  L  +L    +RV  I PGL          FK +  +G  +K + N VA
Sbjct:    6 TGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDN------LYIAQLDVR-NRAAIEEMLASLPAEWCNIDILVNNAGLALGMEPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERN-HGHIINIGSTAGS--WPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSNVRFKGD--DGKAEKTYQNTVA 206          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
Y4VI_RHISN3.077e-1227.31Uncharacterized short-chain type dehydrogenase/red... [more]
LINC_PSEPA3.077e-1224.592,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydroge... [more]
KDSR_HUMAN3.077e-1229.733-ketodihydrosphingosine reductase OS=Homo sapiens... [more]
FOX2_CANTR3.077e-1229.12Peroxisomal hydratase-dehydrogenase-epimerase OS=C... [more]
DHRS1_MOUSE3.077e-1230.62Dehydrogenase/reductase SDR family member 1 OS=Mus... [more]
YDFG_ECOLI4.019e-1230.05NADP-dependent L-serine/L-allo-threonine dehydroge... [more]
DRS7B_RAT4.019e-1228.71Dehydrogenase/reductase SDR family member 7B OS=Ra... [more]
CBR4_XENTR5.093e-1227.03Carbonyl reductase family member 4 OS=Xenopus trop... [more]
YTKK_BACSU5.249e-1226.86Putative oxidoreductase ytkK OS=Bacillus subtilis ... [more]
YDFG_ECO575.249e-1230.05NADP-dependent L-serine/L-allo-threonine dehydroge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top