EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PGDH_RAT (15-hydroxyprostaglandin dehydrogenase [NAD+] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 5.249e-12
Identity = 62/233 (26.61%), Postives = 113/233 (48.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNL----TGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG--VAYASSKAGLNAMTKCLSLELGVHK--IRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRD----FGTTDPA 655
            TGA+ G+G+ F   L   G ++      ++   + K+  DE  +      + + ++ DV A+   + ++ +   + FGR+D LVNNAGV+          E+ W   ++ NL    +G++L   Y  +  ++  + G +INISSIA    G +P      Y +SK G+   T+  ++   + K  +R+N ICPG  K+ I E + K++ +      T  ++     +G  DP+
Sbjct:   11 TGAAQGIGKAFTEALLLHGAKVALVDWNLETGVKCKAALDEQFEPQ----KTLFIQCDV-ADQKQLRDTFRKVVDHFGRLDILVNNAGVN---------NEKNWEQTLQINLVSVISGTYLGLDY--MSKQNGGEGGIIINISSIA----GLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVKTPILESIEKEENMGQYIEYTDQIKAMMKFYGILDPS 223          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MTDH_UROFA (Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.249e-12
Identity = 64/239 (26.78%), Postives = 107/239 (44.77%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDAN-QEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTF 715
            TG + G+G       A AG  +          +    EI+K+ G  V+  A + DV      ++   +   E  G +  L+ NAGVS  VK  L   ++++N I   N+ G +  ++ +     D   Q GSV+ ISS+++    +      Y SSKA ++ + KCL+ E     IRVN + PG  K++ T  + +K  L +  +   PL+ F   +      +  L   +S M  G +
Sbjct:   15 TGGNRGIGLAMSQACADAGAAVGIIYNSAKDAEDRASEISKKYG--VKCKAYQCDVGQQHK-VKEVFKKINEELGPVTGLIANAGVS-VVKEALQYNKDDFNKIFDVNVFGVFNCAQAMAQIWTDTGFQRGSVVIISSMSSQICNRPLTQCFYNSSKAAVSNLGKCLAAEWAEKSIRVNMLSPGYVKTDQTSHMDQK--LRDFQADGVPLKRFAEPEEMAGQAILLLSPKASYMTGGEY 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BACC_BACAM (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus amyloliquefaciens GN=bacC PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.855e-12
Identity = 58/203 (28.57%), Postives = 99/203 (48.77%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAG-LNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNN 604
            TG +SG+G             +V A   +D  +    E   +  ++ R   V+ D++ N  A +N++  A + FG +D L+NNAG+   + +P+ ++   +WN ++  NLTG +L+SK+    M  +  +G++IN  S+        P   AY +SK G L          +  H IRVN +CPG+  + + E    K +L N
Sbjct:   11 TGGASGIGYAAVQAFLNQQANVVVAD--IDEAQG---EAMIRKENNDRLHFVQTDIT-NEPACQNAILSAVDKFGGLDVLINNAGIE--IVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSG-KGNIINTCSVGGVV--AWPDIPAYNASKGGVLQTDAFYRPSIIAKHNIRVNCVCPGIIDTPLNE----KSFLEN 198          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHBB_CHRVI (Acetoacetyl-CoA reductase OS=Chromatium vinosum GN=phbB PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.953e-12
Identity = 66/239 (27.62%), Postives = 112/239 (46.86%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMA---WEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG   G+G   C  LAK GC +VA     +   +  +E  +   +    +AV    +A+ ++ ++S +M     E  G ID LVN AG++   K+   + +  W  ++  NL   + V++ V   M +    G +INISS+    RGQ  G   Y+++KAG++  T  L+ E     + VN+I PG  ++ +T  L   D + N      P+R     +  + + + +L  D S    G
Sbjct:    8 TGGIGGIGTSICTRLAKDGCTVVANCHPSEA--AAAEEWKQARAAEGFDIAV---FTADVSSFDDSARMVREITEQVGPIDILVNCAGITRD-KTFKKMEQAHWEAVINVNLNSVFNVTRQVWDGMLERGF-GRIINISSVNG-QRGQF-GQANYSAAKAGMHGFTMALAQEGASKGVTVNTISPGYVETAMT--LAMNDDVRNSIISGIPMRRMAQPN-EIAAAIAFLAGDESGYMTG 234          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BUDC_KLETE (Acetoin(diacetyl) reductase OS=Klebsiella terrigena GN=budC PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.953e-12
Identity = 54/188 (28.72%), Postives = 89/188 (47.34%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKS 562
            TGA  G+G+   L L K G  +  A        ++  EIN+  G   RA+A+++DVS        +V+ A +A G  + +VNNAG+  A  +P++ +TEE  + +   N+ G     +      +     G ++N  S A       P    Y+SSK  +  +T+  + +L    I VN  CPG+ K+
Sbjct:    8 TGAGQGIGKAIALRLVKDGFAVAIADYNDATATAVAAEINQAGG---RAVAIKVDVSRRDQVFA-AVEQARKALGGFNVIVNNAGI--APSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKKEGHGGKIVNACSQAGHVGN--PELAVYSSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKT 187          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YXNA_BACSU (Uncharacterized oxidoreductase yxnA OS=Bacillus subtilis GN=yxnA PE=3 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 61/193 (31.61%), Postives = 91/193 (47.15%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHK--IRVNSICPGLFKSEITE 574
            TGASSG+G       A+ G ++VAAAR  + LK L DE+ K+ G    A+ V+ DV      +    + A   FGR D  VNNA VS      +D+T E+   +  TN  G    ++            G++IN+ S+    RG +     YAS+K  L+  T+ + +EL   +  + V  I PG   +   E
Sbjct:   37 TGASSGIGLVTARMAAEKGAKVVAAARNEEALKELTDEL-KEKGHD--AIWVKADVGKE-EDVNRIAETAISTFGRFDTWVNNAAVS-TFGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTGRGVPGALINVGSLFG-DRGTVIQS-TYASAKFALHGWTESIRMELEKEQAPVSVTLIHPGRIDTPYNE 222          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YCIK_ECOLI (Uncharacterized oxidoreductase yciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 48/186 (25.81%), Postives = 92/186 (49.46%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEA---FGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TGAS G+GRE  +  A+ G  ++   R  ++L+ +   IN+++G   +   ++L    +    EN  Q+A      + R+D +++NAG+ G V    +   + W  +M+ N+  ++++++ +   +  ++    V   SS+    R       AYA+SK     M + L+ E    ++RVN I PG
Sbjct:   18 TGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFILDLLTCTS----ENCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWG---AYAASKFATEGMMQVLADEY-QQRLRVNCINPG 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_ASPOR (3-ketoacyl-CoA reductase OS=Aspergillus oryzae GN=AO090026000492 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 59/194 (30.41%), Postives = 94/194 (48.45%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L DEI  +  +SV+   + +D + N  +    ++   +    +  LVNN G S  + +P  LT +EE   I+  N  G+   ++ +   M    + G ++ + S      G LP  +   Y+ SKA L   +  L  EL  H I V  +   L  S +++
Sbjct:   73 TGASDGLGKEFSLQLARAGFNIVLVSRTASKLTTLSDEITSKY-ASVQTKTLAMDFARNEDSDYEKLKALVDELD-VAILVNNVGKSHDIPTPFALTSQEEMTDIITINCMGTLRATQLIVPGMMQ-RKRGLILTMGSFG----GLLPTPLLATYSGSKAFLQQWSTALGSELEEHGITVELVQAYLITSAMSK 259          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_ASPFU (3-ketoacyl-CoA reductase OS=Aspergillus fumigatus GN=AFUA_2G11540 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 59/194 (30.41%), Postives = 94/194 (48.45%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L +EI  +   SV+   + +D +AN  A    ++   +    +  L+NN G S  + +P  LT E+E   I+  N  G+   ++ +   M    + G V+ + S      G LP  +   Y+ SKA L   +  L  EL  + I V  +   L  S +++
Sbjct:   73 TGASDGLGKEFSLQLARAGFNIVLVSRTASKLTTLAEEITTK--HSVQTKTLAMDYAANNDADYEELKAIVDGLD-VAVLINNVGKSHDIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQ-RKRGLVLTMGSFG----GLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSK 258          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_ASPFC (3-ketoacyl-CoA reductase OS=Aspergillus fumigatus (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 59/194 (30.41%), Postives = 94/194 (48.45%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L +EI  +   SV+   + +D +AN  A    ++   +    +  L+NN G S  + +P  LT E+E   I+  N  G+   ++ +   M    + G V+ + S      G LP  +   Y+ SKA L   +  L  EL  + I V  +   L  S +++
Sbjct:   73 TGASDGLGKEFSLQLARAGFNIVLVSRTASKLTTLAEEITTK--HSVQTKTLAMDYAANNDADYEELKAIVDGLD-VAVLINNVGKSHDIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQ-RKRGLVLTMGSFG----GLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSK 258          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
PGDH_RAT5.249e-1226.6115-hydroxyprostaglandin dehydrogenase [NAD+] OS=Ra... [more]
MTDH_UROFA5.249e-1226.78Probable NADP-dependent mannitol dehydrogenase OS=... [more]
BACC_BACAM6.855e-1228.57Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
PHBB_CHRVI8.953e-1227.62Acetoacetyl-CoA reductase OS=Chromatium vinosum GN... [more]
BUDC_KLETE8.953e-1228.72Acetoin(diacetyl) reductase OS=Klebsiella terrigen... [more]
YXNA_BACSU1.169e-1131.61Uncharacterized oxidoreductase yxnA OS=Bacillus su... [more]
YCIK_ECOLI1.169e-1125.81Uncharacterized oxidoreductase yciK OS=Escherichia... [more]
MKAR_ASPOR1.169e-1130.413-ketoacyl-CoA reductase OS=Aspergillus oryzae GN=... [more]
MKAR_ASPFU1.169e-1130.413-ketoacyl-CoA reductase OS=Aspergillus fumigatus ... [more]
MKAR_ASPFC1.169e-1130.413-ketoacyl-CoA reductase OS=Aspergillus fumigatus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top