EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_AJECN (3-ketoacyl-CoA reductase OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 56/194 (28.87%), Postives = 97/194 (50.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTE-EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS G+G+E+ L LA+AG  I+  +R   +L ++ DEI K    +V+     +D   N      ++++  +    I  LVNN G S ++ +P  LT  EE  +I+  N TG+  +++ V   M    + G ++ ++S A    G +P  +   Y  SKA L   +  L  EL  + ++V  +   L  S +++
Sbjct:   66 TGASDGIGKEYSLQLARAGYNILLVSRTTSKLAAVADEI-KSKSPTVQTKVFAMDFFKNNDGDYENLKLLIQDLD-ISILVNNVGRSHSIPTPFVLTPLEELENIIMINCTGTLRITQLVAPGMMQ-RKRGLILTMASFA----GMIPTPLLATYCGSKAFLQYWSIALGAELQPYGVQVELVQSHLVTSAMSK 252          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MFEA_DICDI (Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 70/250 (28.00%), Postives = 110/250 (44.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAI----------ENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGA  G+G+ + L+ AK G ++V        +  L      Q  SS  A  V  ++ A G             E  VQ A ++FG +D L+NNAG+   V S   +T+ +W+ + + +  G++ +S+     MR+ N  G +I  SS AA   G   G   Y S K  L  ++  L+ E     I  N+I P +  S +TE +M  + L  +        D+      +  LV YL H  +    G F +
Sbjct:   13 TGAGGGIGKVYALEFAKRGAKVV--------VNDLGGSHTGQGSSSKAADKVVEEIKAAGGTAVANYDSVEDGEKIVQTAMDSFGGVDILINNAGILRDV-SFGKMTDGDWDLVYRVHAKGAYKLSRAAWNHMREKN-FGRIIMTSS-AAGLYGNF-GQANYGSMKMALVGLSNTLAQEGKSKNIHCNTIAP-IAASRLTESVMPPEILEQMKP------DY------IVPLVLYLCHQDTTETGGVFEV 237          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB4_RAT (Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 69/249 (27.71%), Postives = 115/249 (46.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVA---------AARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGA  GLGR + L  A+ G  +V            +       + +EI ++ G   +A+A    V A     E  V+ A + FGRID +VNNAG+    +S   +++E+W+ I + +L GS+ V++     M+  N  G +I  +S A+   G   G   Y+++K GL  +   L +E   + I  N+I P    S +TE +M +D +  +                +  LV +L H+S +   G F +
Sbjct:   15 TGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRRGG---KAVANYDSVEAG----EKLVKTALDTFGRIDVVVNNAGIL-RDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNY-GRIIMTAS-ASGIYGNF-GQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNA-GSRMTETVMPEDLVEALKPE------------YVAPLVLWLCHESCEENGGLFEV 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DECR2_PONAB (Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.169e-11
Identity = 63/197 (31.98%), Postives = 103/197 (52.28%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRM-RDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMK 586
            TG  SG+G        + GC  V A+R + R+ +   ++   +G   R + + +DV A  A +  +V  A + FGRID L+N A  +G    P   L+   +  +M  + +G++ VS+ +  +  RD    G ++NI++    +RGQ    V   S+KA ++AMT+ L++E G   IRVNS+ PG      TEGL +
Sbjct:   34 TGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGR--RCLPLSMDVRAPPAIVA-AVDQALKEFGRIDILINCA--AGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHG--GVIVNITATLG-NRGQALQ-VHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISG--TEGLRR 219          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PGDH_MACFA (15-hydroxyprostaglandin dehydrogenase [NAD+] OS=Macaca fascicularis GN=HPGD PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 61/234 (26.07%), Postives = 112/234 (47.86%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNL----TGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG--VAYASSKAGLNAMTKCLSLELGVHK--IRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRD----FGTTDPAL 658
            TGA+ G+GR F   L   G ++      ++   + K+  DE  +      + + ++ DV A+   + ++ +   + FGR+D LVNNAGV+          E+ W   ++ NL    +G++L   Y  +  ++  + G +IN+SS+A    G +P      Y +SK G+   T+  +L   +    +R+N+ICPG   + I E + K++ +         ++D    +G  DP L
Sbjct:   11 TGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEKFEPQ----KTLFIQCDV-ADQQQLRDTFRKVVDHFGRLDILVNNAGVN---------NEKNWEKTLQINLVSVISGTYLGLDY--MSKQNGGEGGIIINMSSLA----GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPL 224          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PGDH_HUMAN (15-hydroxyprostaglandin dehydrogenase [NAD+] OS=Homo sapiens GN=HPGD PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 61/234 (26.07%), Postives = 112/234 (47.86%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNL----TGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG--VAYASSKAGLNAMTKCLSLELGVHK--IRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRD----FGTTDPAL 658
            TGA+ G+GR F   L   G ++      ++   + K+  DE  +      + + ++ DV A+   + ++ +   + FGR+D LVNNAGV+          E+ W   ++ NL    +G++L   Y  +  ++  + G +IN+SS+A    G +P      Y +SK G+   T+  +L   +    +R+N+ICPG   + I E + K++ +         ++D    +G  DP L
Sbjct:   11 TGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQ----KTLFIQCDV-ADQQQLRDTFRKVVDHFGRLDILVNNAGVN---------NEKNWEKTLQINLVSVISGTYLGLDY--MSKQNGGEGGIIINMSSLA----GLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPL 224          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HETN_ANASP (Ketoacyl reductase hetN OS=Anabaena sp. (strain PCC 7120) GN=hetN PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 57/184 (30.98%), Postives = 89/184 (48.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS-GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TGAS GLG      LAK    +V  +R    L   C+ +    G   +A+A+  DV  N + +   VQ A +  G ID L+NNAG+      +   L E +   I  TNL  +  +++ +   M +    G ++NI+S+A   +G     V Y++SKAGL   T  +  EL    + ++ +CPG
Sbjct:   12 TGASRGLGVYIARALAKEQATVVCVSRSQSGLAQTCNAVKAAGG---KAIAIPFDV-RNTSQLSALVQQAQDIVGPIDVLINNAGIEINGTFANYSLAEIQ--SIFNTNLLAAMELTRLLLPSMMERG-SGRIVNIASLAG-KKGVAFNSV-YSASKAGLIMWTDAMRQELVGTGVNISVVCPG 186          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB4_HUMAN (Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 68/249 (27.31%), Postives = 115/249 (46.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---------RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGA +GLGR + L  A+ G  +V      D             + +EI ++ G +V       D    G   E  V+ A +AFGRID +VNNAG+    +S   +++E+W+ I + +L GS+ V++     M+   Q+   I ++S A+   G   G   Y+++K GL  +   L++E     I  N+I P    S +T+ +M +D +  +                +  LV +L H+S +   G F +
Sbjct:   15 TGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAV----ANYDSVEEG---EKVVKTALDAFGRIDVVVNNAGIL-RDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMK--KQKYGRIIMTSSASGIYGNF-GQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNA-GSRMTQTVMPEDLVEALKPE------------YVAPLVLWLCHESCEENGGLFEV 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB14_HUMAN (17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 54/194 (27.84%), Postives = 94/194 (48.45%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISS-IAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TG   G+G         +G R+V   +     ++L  E+         A+ +  DV+     ++  V      FGR+D +VNNAG     + P + + + +  +++ NL G++ ++K     +R    +G+VINISS + A  + Q    V Y ++K  + AMTK L+L+   + +RVN I PG   + + E L
Sbjct:   15 TGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPG-------AVFILCDVTQEDD-VKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLR--KSQGNVINISSLVGAIGQAQ---AVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEEL 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DECR2_HUMAN (Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.527e-11
Identity = 63/197 (31.98%), Postives = 103/197 (52.28%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRM-RDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMK 586
            TG  SG+G        + GC  V A+R + R+ +   ++   +G   R + + +DV A  A +  +V  A + FGRID L+N A  +G    P   L+   +  +M  + +G++ VS+ +  +  RD    G ++NI++    +RGQ    V   S+KA ++AMT+ L++E G   IRVNS+ PG      TEGL +
Sbjct:   34 TGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGR--RCLPLSMDVRAPPAVMA-AVDQALKEFGRIDILINCA--AGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHG--GVIVNITATLG-NRGQALQ-VHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISG--TEGLRR 219          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
MKAR_AJECN1.169e-1128.873-ketoacyl-CoA reductase OS=Ajellomyces capsulata ... [more]
MFEA_DICDI1.169e-1128.00Peroxisomal multifunctional enzyme A OS=Dictyostel... [more]
DHB4_RAT1.169e-1127.71Peroxisomal multifunctional enzyme type 2 OS=Rattu... [more]
DECR2_PONAB1.169e-1131.98Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abe... [more]
PGDH_MACFA1.527e-1126.0715-hydroxyprostaglandin dehydrogenase [NAD+] OS=Ma... [more]
PGDH_HUMAN1.527e-1126.0715-hydroxyprostaglandin dehydrogenase [NAD+] OS=Ho... [more]
HETN_ANASP1.527e-1130.98Ketoacyl reductase hetN OS=Anabaena sp. (strain PC... [more]
DHB4_HUMAN1.527e-1127.31Peroxisomal multifunctional enzyme type 2 OS=Homo ... [more]
DHB14_HUMAN1.527e-1127.8417-beta-hydroxysteroid dehydrogenase 14 OS=Homo sa... [more]
DECR2_HUMAN1.527e-1131.98Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top