EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: XYLL_PSEPU (1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.994e-11
Identity = 60/246 (24.39%), Postives = 113/246 (45.93%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP-------GLFKSEITEGLMKKDWLNNVASRTYP---LRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA+ G+GR     +A  G R++   R  + +  L DE+     + V  +  +L+  A     +  +  A E FGR+D L+NN G +   K      E E    ++ +L  + L   +  +        G+++N+SS+A     ++P    Y ++K G+NA+T CL+ E     IRVN+  P       G F++       +K W   +  ++     ++ +G+ D  + +++ +L  D++    G
Sbjct:   13 TGAAQGIGRRVAERMAAEGGRLLLVDRS-ELIHELADEL--VGVAEVLTLTADLEQFAE---CQRVMAAALERFGRLDILINNVGGTIWAKPFEHYQEREIEAEVRRSLFPT-LWCCHAALAPMIEQGSGAIVNVSSVATRGIHRVP----YGAAKGGVNALTACLAFETAERGIRVNATAPGGTEARHGGFRNSAEPSEQEKVWYQQIVDQSLDSSLMKRYGSIDEQVEAIL-FLASDAASYITG 246          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCD2_MOUSE (3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 1.994e-11
Identity = 50/144 (34.72%), Postives = 80/144 (55.56%), Query Frame = 2
Query:  188 IENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDL-----TEEEWNHIMKTNLTGSWLVSKYVCIRMRD-----ANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            I+ ++ +A E FGRID  VN AG++ A+K+         T E++  ++  NL G++ V + V   M         Q G +IN +S+AA   GQ+ G  AY++SK G++ MT  ++ +L    IRV +I PGLF + +   L +K
Sbjct:   71 IQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFE-GQV-GQAAYSASKGGIDGMTLPIARDLAPTGIRVVTIAPGLFATPLLTTLPEK 212          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_NEOFI (3-ketoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.605e-11
Identity = 59/194 (30.41%), Postives = 93/194 (47.94%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L +EI  +   SV+   + +D +AN  A    ++        +  L+NN G S  + +P  LT E+E   I+  N  G+   ++ +   M    + G V+ + S      G LP  +   Y+ SKA L   +  L  EL  + I V  +   L  S +++
Sbjct:   73 TGASDGLGKEFSLQLARAGFNIVLVSRTASKLTTLAEEITTK--HSVQTKTLAMDFAANDDADYEELKAIVNGLD-VAVLINNVGKSHDIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQ-RKRGLVLTMGSFG----GLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSK 258          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCD2_RAT (3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 2.605e-11
Identity = 64/210 (30.48%), Postives = 96/210 (45.71%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQ----MAWEAFGRIDALVNNAGVSGAVKSPLDL-----TEEEWNHIMKTNLTGSWLVSKYVCIRMRD-----ANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TG +SGLG      L   G   V           L D  N +  +  + +      +      E  VQ    +A E FGRID  VN AG++ A+K+  +      T E++  ++  NL G++ V + V   M         Q G +IN +S+AA   GQ+ G  AY++SK G+  MT  ++ +L    IRV +I PGLF + +   L  K
Sbjct:   16 TGGASGLGLSTAKRLVGQGATAV-----------LLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFE-GQV-GQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDK 212          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_RAT (Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.605e-11
Identity = 59/212 (27.83%), Postives = 103/212 (48.58%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            G S G+G+     +A+ G R+   AR ++  K+   E+     +    +A E DV +    +E  +       G ++ LVN AG++         TE+  + +  TNL G+ L  +     M    Q GS++N+ SI    +G + G  AY+++K GL   ++ L+ E+   KIRVN + PG   +++T+ L ++ +  N+     PL  FG
Sbjct:    9 GGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDVHSTFEEMEKHL-------GPVNFLVNAAGINRDSLLVRTKTEDMLSQL-HTNLLGTMLTCRAAMRTM--IQQGGSIVNVGSIIGL-KGNV-GQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEHFKKNI-----PLGRFG 203          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YJDA_BACSU (Uncharacterized oxidoreductase yjdA OS=Bacillus subtilis GN=yjdA PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 68/241 (28.22%), Postives = 111/241 (46.06%), Query Frame = 2
Query:    2 TGASS--GLGREFCLDLAKAGCRIVAAARRVDR--LKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQ-EGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGASS   +G   C  LA  G  I       D   ++    EI +     VR  A+++D+S   AA     +++ +  G    L+NNA  S A  + + L  +  +     N+  ++L+      R + +N   G +IN++S      G LPG +AYA++K  ++A T+ LS EL    I VN++ PG      T+     D + N  S  +P+   GT D A   ++ +L  D ++   G
Sbjct:   12 TGASSQGDIGTAICRKLASQGIHIFFTHWNSDTAWIEEFQQEILRMG---VRCEAMKIDLSDAHAAFTIHEKIS-DKLGYPSILINNAAHS-ASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLISGRIINMTS--GQDLGPLPGELAYAATKGAISAFTRSLSQELAPLGITVNAVNPG-----PTDSTWMTDEIRNFLSPKFPMGRIGTPDDA-ARMIAFLASDEAEWITG 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_ASPCL (3-ketoacyl-CoA reductase OS=Aspergillus clavatus GN=ACLA_070510 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 59/194 (30.41%), Postives = 91/194 (46.91%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS GLG+EF L LA+AG  IV  +R   +L +L +EI  +     R +A  +D +AN       ++   +    +  L+NN G S  +  P  LT E+E   I+  N  G+   ++ V   M    + G V+ + S      G LP  +   Y+ SKA L   +  L  EL  + I V  +   L  S +++
Sbjct:   73 TGASDGLGKEFALQLARAGFNIVLVSRTASKLATLAEEITAKHSVQTRTLA--MDFAANDDTDYEDLKTLVDGLD-VSILINNVGKSHDIPVPFALTPEDEMTDIVTINCLGTLRATQLVIPGMMQ-RRRGLVLTMGSFG----GLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSK 258          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCD2_BOVIN (3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 62/206 (30.10%), Postives = 96/206 (46.60%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGA-----VKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRD-----ANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TG +SGLG      L   G   V         ++   ++ K    +   +  E DV A       ++ +A E FGR+D  VN AG++ A     +K     T E++  ++  NL G++ V + V   M         Q G +IN +S+AA   GQ+ G  AY++SK G+  MT  ++ +L    IRV +I PGLF + +   L  K
Sbjct:   16 TGGASGLGLATAERLVGQGATAVLLDLPNSDGETQAKKLGKSCAFAPADVTSEKDVQA-------ALTLAREKFGRVDVAVNCAGIAVASKTYNLKKSQAHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFE-GQV-GQAAYSASKGGIVGMTLPIARDLAPMGIRVMTIAPGLFGTPLLTTLPDK 212          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DECR2_DANRE (Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 55/184 (29.89%), Postives = 94/184 (51.09%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TG  SG+G      L + GC  V A+R ++++     ++   +G   R + + +DV      I  +V    + FGR+D L+NNA  +G    P   L+   +  +M+ +  G++  SK +  +    +  GS++NIS+     RGQ    V   S+KA  +AMT+ L++E G   +RVN++ PG
Sbjct:   41 TGGGSGIGFRIAEVLMRHGCDTVIASRNLEKISQAAKKLTSTTGR--RCLPIAMDVR-QPETILAAVDETLKTFGRVDILINNA--AGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFK-DHGGSIVNISATLGY-RGQALQ-VHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPG 216          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BDH2_BOVIN (3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.402e-11
Identity = 55/185 (29.73%), Postives = 92/185 (49.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGV--SGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            T A+ G+GR   L  AK G +++A     D   S   E++K  G   R + V      +  A  N ++       R+D L N AG    G +   LD  E +W+  M  N+   +L+ K    +M  A + G++IN+SS+A++ +G +   V Y+++KA +  +TK ++ +     IR N +CPG
Sbjct:   12 TAAAQGIGRAAALAFAKEGAKVIAT----DINDSKLQELDKYPGIHTRVLDVTKKKQIDQFA--NDIE-------RLDVLFNVAGFVHHGTI---LDCEETDWDFSMNLNVRSMYLMIKAFLPKMM-AQKSGNIINMSSVASSIKGVVNRCV-YSTTKAAVIGLTKSVAADFIQQGIRCNCVCPG 178          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
XYLL_PSEPU1.994e-1124.391,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh... [more]
HCD2_MOUSE1.994e-1134.723-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musc... [more]
MKAR_NEOFI2.605e-1130.413-ketoacyl-CoA reductase OS=Neosartorya fischeri (... [more]
HCD2_RAT2.605e-1130.483-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus n... [more]
CBR4_RAT2.605e-1127.83Carbonyl reductase family member 4 OS=Rattus norve... [more]
YJDA_BACSU3.402e-1128.22Uncharacterized oxidoreductase yjdA OS=Bacillus su... [more]
MKAR_ASPCL3.402e-1130.413-ketoacyl-CoA reductase OS=Aspergillus clavatus G... [more]
HCD2_BOVIN3.402e-1130.103-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taur... [more]
DECR2_DANRE3.402e-1129.89Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rer... [more]
BDH2_BOVIN3.402e-1129.733-hydroxybutyrate dehydrogenase type 2 OS=Bos taur... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top