EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YXEK_CAEEL (Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans GN=F53C11.3 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.443e-11
Identity = 56/189 (29.63%), Postives = 89/189 (47.09%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRI-DALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE 565
            TG  +GLG+      A  G  +  AARR+D L+   DEI   +G       +++   A  A   ++V+   +  G   D L+NNA     + +   L+   +  I+   L G+  V+  +  R     +  SV++I+++ A S    P  V  A SKAG+  MTK L+ E   H +R N+I PG   +E
Sbjct:   32 TGGGTGLGKAIATTFAHLGASVAIAARRLDVLEKTADEIRSSTGGVCEPFQMDVKDPAKVAKAFDAVE---KKLGHTPDILINNA-AGNFIMATERLSPNAYGTIIDIVLKGTLHVTTELGRRCIQQKRGASVLSITTLYAQSGA--PFVVPSAVSKAGVENMTKSLASEWAKHGLRFNAIAPGPIPTE 214          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PGDH_CAVPO (15-hydroxyprostaglandin dehydrogenase [NAD+] OS=Cavia porcellus GN=HPGD PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.443e-11
Identity = 60/234 (25.64%), Postives = 112/234 (47.86%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVD---RLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNL----TGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG--VAYASSKAGLNAMTK--CLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRD----FGTTDPAL 658
            TGA+ G+GR F   L   G ++      ++   + K+  DE  +      + + ++ DV A+   + ++     + FGR+D LVNNAGV+          E+ W   ++ NL    +G++L   Y  +  +   + G +IN+SS+A    G +P      Y +SK G+   T+   ++ +L    +R+N+ICPG   + I + + K++ +      T  ++D    +G  DP +
Sbjct:   11 TGAAQGIGRAFAEGLLHKGAKVALVDWNLEAGVKCKAALDEEFEPQ----KTLFIQCDV-ADQEQLRDTFTKVVDYFGRLDILVNNAGVN---------NEKNWEKTLQINLVSVISGTYLGLDY--MSKQHGGEGGVIINMSSLA----GLMPVAQQPVYCASKHGIIGFTRSAAMARKLMNSGVRMNAICPGFVNTSILQSIEKEENMGPYIEYTGHIKDMMKCYGILDPEM 224          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: NYC1_ORYSJ (Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.443e-11
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEI--NKQSGSSV---RAMAVELDVSANGAA--------IENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG++ GLG+    +   +G R+V A+R  + +    +E+  N Q G SV   +   + L     G +        ++  V  A +  G ID  +NNAG +   +  ++ ++E+ + I+ TNL GS L ++     M+   + G V N+   A +     P    Y S+K GL      L  E    K+ V++  PG+  +++
Sbjct:  176 TGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINELEENIQEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAGTNKGFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDG-AGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL 376          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: NOL_ORYSJ (Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.443e-11
Identity = 49/193 (25.39%), Postives = 91/193 (47.15%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLEL---GVHKIRVNSICPGLFKSEI 568
            TG++ G+G     +  KAG  +V  +R  +R++S   ++ K+ G       +  DV   G  ++  V  A +    ID  +NNAG +     PL + ++E    ++ TN  G  +  +     MR+  + G + NI    +  R   P   AY ++K  +  +TK L  EL    V+ + V+++ PG+  +++
Sbjct:   79 TGSTKGIGYALAKEFLKAGDNVVICSRSAERVESAVTDLKKEFGEQ-HVWGIVCDV-REGKDVKALVDFARDKMKYIDIWINNAGSNAYSYKPLVETSDEALMEVITTNTLGLMICCREAINMMRNQPRGGHIFNIDGAGSDGR-PTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVTTDL 268          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: MKAR_VANPO (3-ketoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.443e-11
Identity = 56/204 (27.45%), Postives = 102/204 (50.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL--DVSANGAAIENSVQMAWEAFGR--IDALVNNAGVSGAVKSP-LDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQE------GSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGAS G+G+EF   +AK G  ++  +R + +L++L  EI+ +    V  +A+++  D   N +AI+       E  G+  I AL+NN G S ++  P L+  E+E   I+  N T + ++++ +   +    +E      G ++ + S      G +P  +   Y+ SKA L + +  L+ EL  H + V  I   L  S +++
Sbjct:   70 TGASDGIGKEFAFQMAKRGFNLILISRTLSKLETLQKEISTKYNVKVEVLAIDVAKDSEDNYSAIK-------ELCGKFPITALINNVGQSHSIPVPFLETDEDEMRRIITINNTATLMITQIIAPMIIKTTKESSKKTRGLILTMGSFG----GLIPTPLLATYSGSKAFLQSWSSSLAGELKEHNVDVELIISYLVTSSMSK 262          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YI78_SCHPO (Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe GN=SPAC977.08 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 53/149 (35.57%), Postives = 83/149 (55.70%), Query Frame = 2
Query:  149 MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE--ITEGLMK 586
            +  +LDV+ N ++I+ SV+ A   FGRID L+NNAG S  V SPL+  TEE+ ++I  TN+ G+  V K +    R +   G +IN+SSI    +   P G  Y  +K  +  +++ L+ E+    ++V  I PG   +E  + EG  K
Sbjct:   17 LVTQLDVN-NFSSIKKSVEKAISHFGRIDVLLNNAGYS--VYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFR-SQHNGMIINVSSIG--GKMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATEFRVEEGAGK 159          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y945_MYCTU (Uncharacterized oxidoreductase Rv0945/MT0971 OS=Mycobacterium tuberculosis GN=Rv0945 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 60/193 (31.09%), Postives = 95/193 (49.22%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNH--IMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPG-GVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGASSGLG       A  G  +   ARR DRL  L  E++ Q    ++    ELDV+ +    +   +++ E  G ID ++ NAG+    +     + + W +   ++TNL  + LV     + M +    G ++ ISS+       +PG   AYA+SKAG+ ++ + L  E     IRV  + PG  +SE+T
Sbjct:   13 TGASSGLGAGMARSFAAQGRDLALCARRTDRLTELKAELS-QRYPDIKIAVAELDVNDHERVPKVFAELSDE-IGGIDRVIVNAGIGKGARLG---SGKLWANKATIETNLVAA-LVQIETALDMFNQRGSGHLVLISSVLGVKG--VPGVKAAYAASKAGVRSLGESLRAEYAQRPIRVTVLEPGYIESEMT 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: TS2_MAIZE (Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 55/192 (28.65%), Postives = 92/192 (47.92%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVR-AMAVELDVSANGAAIENSVQMA--WEAF---GRIDALVNNAGVSG----AVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG + G+G       AK G R+V A            +I+  +G ++  A+  ++       ++E+ V+ A  W      GR+D   NNAGV G    A +S L     E++ +++ N  G+ L  K+   R     + GS+++++S+AA   G  P   AY +SK  +  +TK  + EL  H +RVN + P
Sbjct:   61 TGGARGIGEAIVRLFAKHGARVVIA------------DIDDAAGEALASALGPQVSFVRCDVSVEDDVRRAVDWALSRHGGRLDVYCNNAGVLGRQTRAARSILSFDAAEFDRVLRVNALGAALGMKHAA-RAMAPRRAGSIVSVASVAAVLGGLGPH--AYTASKHAIVGLTKNAACELRAHGVRVNCVSP 237          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_SCHPO (3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe GN=oar2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 66/223 (29.60%), Postives = 109/223 (48.88%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGS--SVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDL--TEEEWNHIMKTNLTGSWLVSKYVCI---RMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTD 649
            TG SSGLG+      ++ G +     R    LK     ++   G   ++    V+ D+  N  +I  SV+        ID +V+ AGV   ++S L +  +E+E + I+ TNL  +  +SK   +   R +++ ++  ++NISS  +T    LPG   YA+SKAGL + TK L+ E+    IRVN+I PG   +      M    +  +A +  P+    +TD
Sbjct:    7 TGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADVQSDMK-NLKSIFESVE--------IDTVVHAAGV---LQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWFRNKNSERDRLILNISSRLSTYA--LPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTP-----MLSSQIRAIAEKKVPIGRLASTD 210          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BDH2_MOUSE (3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.803e-11
Identity = 53/185 (28.65%), Postives = 90/185 (48.65%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGV--SGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            T A+ G+GR   L  A+ G +++A     D  +S   E+    G   R     LDV+      +  +        RID L N AG    G +   LD  E++W+  M  N+   +L+ K    +M  A + G++IN+SS+A++ +G +     Y+++KA +  +TK ++ +     IR N +CPG
Sbjct:   12 TAAAQGIGRASALAFAREGAKVIAT----DINESKLQELESYRGIQTRV----LDVTK-----KRQIDQFASEIERIDVLFNVAGFVHHGTI---LDCEEKDWDFSMNLNVRSMFLMIKAFLPKML-AQKSGNIINMSSVASSIKG-VENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPG 178          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
YXEK_CAEEL4.443e-1129.63Uncharacterized oxidoreductase F53C11.3 OS=Caenorh... [more]
PGDH_CAVPO4.443e-1125.6415-hydroxyprostaglandin dehydrogenase [NAD+] OS=Ca... [more]
NYC1_ORYSJ4.443e-1125.74Probable chlorophyll(ide) b reductase NYC1, chloro... [more]
NOL_ORYSJ4.443e-1125.39Chlorophyll(ide) b reductase NOL, chloroplastic OS... [more]
MKAR_VANPO4.443e-1127.453-ketoacyl-CoA reductase OS=Vanderwaltozyma polysp... [more]
YI78_SCHPO5.803e-1135.57Uncharacterized oxidoreductase C977.08/C1348.09 OS... [more]
Y945_MYCTU5.803e-1131.09Uncharacterized oxidoreductase Rv0945/MT0971 OS=My... [more]
TS2_MAIZE5.803e-1128.65Sex determination protein tasselseed-2 OS=Zea mays... [more]
FABG_SCHPO5.803e-1129.603-oxoacyl-[acyl-carrier-protein] reductase OS=Schi... [more]
BDH2_MOUSE5.803e-1128.653-hydroxybutyrate dehydrogenase type 2 OS=Mus musc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top