EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PECR_MOUSE (Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus GN=Pecr PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.689e-16
Identity = 71/262 (27.10%), Postives = 129/262 (49.24%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQ--SGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIR-MRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI---TEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSLLILGLRYXVSLFSLP 766
            TG  +G+G+    +L   GC +V A+R++DRL +  DE+       SS    A++ ++      + N V+     +G+I+ LVNN G  G   +P+ D+T + W+ +++TNLTG++ + K V    MR+    GS++NI  I   + G  P      +++ G+  +TK ++L      +R+N + PG   S+      G M +  L  +A  + P +  G  +  ++ LV +L+  ++    G    +  G       FS+P
Sbjct:   24 TGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNIRKE-EEVSNLVKSTLAKYGKINFLVNNGG--GQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMRE--HGGSIVNI--IVLLNNG-FPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQT-LFEMAFDSIPAKRLGVPE-EISPLVCFLLSPAASYITGQLINVDGGQALYTHAFSIP 275          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FADH_BACSU (Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis GN=fadH PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.689e-16
Identity = 68/239 (28.45%), Postives = 122/239 (51.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELG-VHKIRVNSICPG-LFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG SSG+G+      A+ G  ++   R  + L+    EI    G   +    ++DV ++ AA  + ++ A +AFGR+DAL+NNA  +G    P + LT   W  +++  L G++  S+       D  Q+G ++N+++  A   G   G V  A++KAG+ ++T+ L++E G  + IR N+I PG + ++   E L + +        + PL   GT +  + +L  +L+ D +    G
Sbjct:    9 TGGSSGMGKAMAKKQAELGWHVMVTGRNHEALEETKKEIQTFEG---QVACFQMDVRSDSAA-SDMIKEAVKAFGRLDALINNA--AGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQAAARHWIDQKQQGVILNMAATYAWGAG--AGVVHSAAAKAGVLSLTRTLAVEWGSKYGIRTNAIAPGPIERTGGAEKLFESEKAMARTMNSVPLGRLGTPE-EIAALAAFLLSDEASYING 238          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_RICCN (3-oxoacyl-[acyl-carrier-protein] reductase OS=Rickettsia conorii GN=fabG PE=3 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 2.689e-16
Identity = 66/236 (27.97%), Postives = 114/236 (48.31%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G      L K G  ++ +    ++L+SL   +            +E+   A+     N +  A     ++D LV NAG++    + + + +E+++ ++  NL  ++++++    +M   N+ G +INISSI   S    PG   Y +SKAGL  MTK LS E+    I VN++ PG  KS++T+ L +K        +  PL  +G  +  +   V +L  D +    G
Sbjct:   12 TGASGGIGGAIARLLHKLGSHVIISGSNEEKLQSLGKVVKDN-------YTIEVCNLADKEECRNLISKA----SKLDILVCNAGITSDTLA-IRMKDEDFDKVIDINLKANFILNREAIKKMIQ-NRYGRIINISSIVGISGN--PGQANYCASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKSDMTDKLNEKQ--REAIVQKIPLGTYGMPED-VAHAVAFLASDQASYITG 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y182_METEA (Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 3.512e-16
Identity = 75/241 (31.12%), Postives = 116/241 (48.13%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE--ITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G      LAK G  +V   A       ++ + I    G   +A+AV+ DVS         V+ A + FGR+D LVNN+GV    A++   ++TEE +  I   N+ G  L ++      +   + GS+INISS+       +P    Y+ +K  LNA++  L+ EL   KIRVN + PG   +E   T G+   +    + ++T PL   G  D  +  +V +L  D +    G
Sbjct:   12 TGASKGIGAAIAKALAKDGAAVVVNYASSKAGADAVVEAITAAGG---KAIAVQADVS-QAVQARGLVEAAVQQFGRLDVLVNNSGVYEFAAIE---EVTEEHYRRIFDVNVLGVLLATQAAS---KHLGEGGSIINISSVVTDVL--MPTSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTAGIAGSEMEAGLVAQT-PLGRSGQPDD-IAGVVAFLASDDARWVTG 238          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_RICBR (3-oxoacyl-[acyl-carrier-protein] reductase OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.512e-16
Identity = 65/236 (27.54%), Postives = 113/236 (47.88%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G      L K G  ++ +    ++LK+L +++       V  +    + S   A IE           ++D LV NAG++    + + +  E+++ ++  NL  ++++++    +M   N+ G +INI+SI   S    PG   Y +SKAGL  MTK L+ E+    I VN++ PG  KS++T+ L   D      +R  P   +G  +  + + V +L    S    G
Sbjct:   12 TGASGGIGGAIARQLHKLGSHVIISGSNEEKLKALGNDLKDNYTIKVCNLTNTEECSNLVAQIE-----------KLDILVCNAGITKDTLA-IRMKNEDFDQVIDINLKANFILNREAIKKMM-TNRYGRIINITSIVGVSGN--PGQANYCASKAGLIGMTKSLAYEVATRGITVNAVAPGFIKSDMTDKL--NDEQKEAITRKIPKGTYGMPED-IANAVAFLASKQSSYITG 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHK2_STRVN (Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.512e-16
Identity = 78/235 (33.19%), Postives = 115/235 (48.94%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDL---TEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGG--VAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVAS---RTYPLRDFGTTD---PALTSLVR 673
            TG+SSG+G+     LA  G R+V  + R        ++  K + +   A+ V  DVS    A    V  A E +GR+D LVNNAG + A+    DL   T E W  I+  N+ G+W  +      +  +   GSV+N+SSIA    G  P G  + YA S  G  A T+ L+  +G   +RVN++ PGL ++  T+     D+   +A    +T PLR  G  +    A+  LVR
Sbjct:   14 TGSSSGIGQTVAQRLAAEGYRVVVNSARS------VEDGEKTAAALPDALYVRADVSEEADA-RRLVDTAVEHYGRLDVLVNNAGRTRAIPH-ADLAAATPEVWREILGLNVIGTWQTTVAAMPHLARSG-NGSVVNVSSIA----GSRPAGSSIPYAVSNGGHRAQTRLLANTVG-PAVRVNAVAPGLIETPWTQ---NSDFFAPIAEHVRQTTPLRRTGRPEDVAEAVLGLVR 231          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DER_CHICK (D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.512e-16
Identity = 73/245 (29.80%), Postives = 118/245 (48.16%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSLLILG 733
            TGA  G+GR   + L KAG R+ A +R    L+SL  E        +  + ++L D  A  AA+         A G  + LVNNA V+  ++  L +T E        N      VS+ V  +M      G+++N+SS A  S+  L     Y S+K+ L+ ++K +++ELG HKIRVN++ P +  +++          +       PL  F   D  + S++ +L+ D S M  G+ SL++ G
Sbjct:   15 TGAGKGIGRAVAVALCKAGARVTALSRTAADLESLVREC-----PGIEPLCLDLADWDATEAAVG--------AAGPFELLVNNAAVA-MLQPFLQVTREAVERSFDVNFRAVLHVSQIVARQMIAQGLPGAIVNVSSQA--SQRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVMTDMGRINWSDPQKSAAMINRIPLGKFAEVDDVVNSIL-FLLSDKSAMTTGS-SLMVDG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HSD_STREX (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.587e-16
Identity = 70/236 (29.66%), Postives = 112/236 (47.46%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG + GLG E       AG R+V A    D L        ++ G + R   +++ +  +   +   V  A E FG +D LVNNAG+S  +    + + E +  ++  NLTG ++  K V   M+DA   GS++NISS A      L    +Y +SK G+  ++K  ++ELG  +IRVNS+ PG+  + +T     +    N  +   P+   G     +   V  L+ D+S    G
Sbjct:   12 TGGARGLGAEAARQAVAAGARVVLA----DVLDEEGAATARELGDAARYQHLDVTIEEDWQRV---VAYAREEFGSVDGLVNNAGISTGMFLETE-SVERFRKVVDINLTGVFIGMKTVIPAMKDAGG-GSIVNISSAAGLMGLALTS--SYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAETGIRQGEGNYPNT--PMGRVGNEPGEIAGAVVKLLSDTSSYVTG 234          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHKR_STRCM (Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.587e-16
Identity = 65/193 (33.68%), Postives = 98/193 (50.78%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIR--MRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TGA+SG+G      LA  G  +   AR       +   +       + A    LDV  +GA++   VQ A + +GRID LVNNAG SG   +  DLT+E W+ ++ TNL   + +++ V     MR   + G +IN++S A      L  G  Y++SK G+   TK L  EL    I VN++CPG  ++ + +
Sbjct:   12 TGATSGIGLATARLLAAQGHLVFLGARTES---DVIATVKALRNDGLEAEGQVLDVR-DGASVTAFVQAAVDRYGRIDVLVNNAGRSGGGVT-ADLTDELWDDVIDTNLNSVFRMTRAVLTTGGMR-TRERGRIINVASTAGKQGVVL--GAPYSASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMAQ 196          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_RAT (L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.587e-16
Identity = 72/238 (30.25%), Postives = 113/238 (47.48%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA  G+GR   L L  AG ++VA +R  + L SL  E        V  + V+L D  A   A+ N         G +D LVNNA V+  ++  L++T+E  +     N      VS+ V   M      G+++N+SS A  S+  L     Y S+K  L+ +TK ++LELG HKIRVN++ P +  + +            V     PL  F   +  + +++ +L+ + S M  G+
Sbjct:   13 TGAGKGIGRSTVLALQAAGAQVVAVSRTREDLDSLVREC-----PGVEPVCVDLADWEATEQALSN--------VGPVDLLVNNAAVA-TLQPFLEVTKEACDTSFNVNFRAVVQVSQIVARGMIARGVPGAIVNVSSQA--SQRALTNHTVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTPMGRANWSDPHKAKVMLDRIPLGKFAEVENVVDTIL-FLLSNRSSMTTGS 233          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
PECR_MOUSE2.689e-1627.10Peroxisomal trans-2-enoyl-CoA reductase OS=Mus mus... [more]
FADH_BACSU2.689e-1628.45Probable 2,4-dienoyl-CoA reductase OS=Bacillus sub... [more]
FABG_RICCN2.689e-1627.973-oxoacyl-[acyl-carrier-protein] reductase OS=Rick... [more]
Y182_METEA3.512e-1631.12Uncharacterized oxidoreductase MexAM1_META1p0182 O... [more]
FABG_RICBR3.512e-1627.543-oxoacyl-[acyl-carrier-protein] reductase OS=Rick... [more]
DHK2_STRVN3.512e-1633.19Granaticin polyketide synthase putative ketoacyl r... [more]
DER_CHICK3.512e-1629.80D-erythrulose reductase OS=Gallus gallus GN=DER PE... [more]
HSD_STREX4.587e-1629.663-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
DHKR_STRCM4.587e-1633.68Monensin polyketide synthase putative ketoacyl red... [more]
DCXR_RAT4.587e-1630.25L-xylulose reductase OS=Rattus norvegicus GN=Dcxr ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top