EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y4LA_RHISN (Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.973e-15
Identity = 72/241 (29.88%), Postives = 118/241 (48.96%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAV---KSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK--DWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA +G+G+   L +A+ G R+V A        +   +I  ++G+   A+A+ +D+ A+  A+    + A   FG +D LVNNA         ++ LDL    W+  M TNL G+ L  +    RM  A   G+++N+SS    S        +YA SKA +N ++  L+ + G  +IR N++ PGL    +TE L+ K    +    SR   L   G  +  + +LV +L+ D +    G
Sbjct:   12 TGAGAGIGKACALAIAREGGRVVVADLDGSAAIACTAQIAAEAGN---ALAMAMDI-ADAQAVAALFETAERHFGGVDLLVNNASAMHLTPRDRAILDLDLAVWDQTMATNLRGTLLCCRQAIPRMI-ARGGGAIVNMSSCQGLSGDTAQ--TSYAVSKAAMNMLSASLATQYGHAQIRCNAVAPGLI---MTERLLAKLDKCMQRHLSRHQLLPRVGHPED-VAALVAFLLSDDASFITG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDUD_DICD3 (2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.973e-15
Identity = 54/194 (27.84%), Postives = 97/194 (50.00%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV---AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TG  +GLG+   + LA+AGC IV     +   K   +++       +   A   D+S + A +E +V      FG++D LVNNAG+    +  ++ +E+ W+ +M  N+   + +S+ V  +       G +INI+S+ +       GG+   +Y +SK  +  +T+ ++ E   H I VN+I PG   +  T+
Sbjct:   16 TGCDTGLGQGMAVGLAEAGCDIVGV--NIVEPKETIEKVTAVGRRFLSLTADMSDISGHAALVEKAVA----EFGKVDILVNNAGIIRR-EDAIEFSEKNWDDVMNLNIKSVFFMSQTVARQFIKQGHGGKIINIASMLS-----FQGGIPVPSYTASKKRVMGITRIVANEWAKHNINVNAIAPGYMATNNTQ 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_MOUSE (L-xylulose reductase OS=Mus musculus GN=Dcxr PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 2.973e-15
Identity = 64/183 (34.97%), Postives = 93/183 (50.82%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL-DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TGA  G+GR   L L  AG ++VA +R  + L  L  E        V  + V+L D  A   A+ N         G +D LVNNA V+  ++  L++T+E  +     NL     VS+ V   M      G+++N+SS A  S+  L     Y S+K  L+ +TK ++LELG HKIRVN++ P
Sbjct:   13 TGAGKGIGRSTVLALKAAGAQVVAVSRTREDLDDLVREC-----PGVEPVCVDLADWEATEQALSN--------VGPVDLLVNNAAVA-LLQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGVPGAIVNVSSQA--SQRALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNP 179          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: STCU_EMENI (Versicolorin reductase OS=Emericella nidulans GN=stcU PE=3 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.883e-15
Identity = 57/192 (29.69%), Postives = 104/192 (54.17%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA  G+G    + L + G ++V   A   +  + + DEI K +GS   A++++ DV  +  A+   +  A E FG +D + +NAG+   G VK   D+T +E++ + + N  G + V++     +R+    G +I  SS  A+ +G +P    Y+ SK  ++   +CL+++ G  KI VN++ PG  K+++
Sbjct:   17 TGAGRGIGAAIAVALGQRGAKVVVNYANSREAAEKVVDEI-KSNGSD--AISIQADVG-DPDAVTKLMDQAVEHFGYLDIVSSNAGIVSFGHVK---DVTPDEFDRVFRVNTRGQFFVAREAYRHLREG---GRIILTSSNTASVKG-VPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDM 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_VIBHA (3-oxoacyl-[acyl-carrier-protein] reductase OS=Vibrio harveyi GN=fabG PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.883e-15
Identity = 56/194 (28.87%), Postives = 100/194 (51.55%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQS-GSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+GR     L + G  ++  A       ++ + + +   G ++    VE        +IE +++   +  G ID LVNNAG++      + + ++EWN I+ TNLT  + +SK V +R     + G +IN+ S+  T      G   YA++KAG+   TK ++ E+    + VN++ PG  ++++T+ L
Sbjct:   11 TGASRGIGRAIAELLVERGATVIGTATSEGGAAAISEYLGENGKGLALNVTDVE--------SIEATLKTINDECGAIDILVNNAGITRD-NLLMRMKDDEWNDIINTNLTPIYRMSKAV-LRGMMKKRAGRIINVGSVVGTMGNA--GQTNYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y3106_PSEAE (Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa GN=PA3106 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.072e-15
Identity = 63/184 (34.24%), Postives = 94/184 (51.09%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TGA+ G+G      L   G ++V A    +R   + + + +       A  V +DV+  G  +  SV      FGR+D LV NA ++    +PL+ L+  EW   +  NLTG  L++KY    +R  N  G+++NI+S  A      P   AYA+SK GL A+T  L+  LG   IRVN++ PG
Sbjct:   16 TGAARGIGLGISAWLIAEGWQVVLADNDRERGARVAEALGEH------AWFVAMDVAQEGQ-VAMSVAEVLGQFGRLDGLVCNAAIANPRNTPLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLRAHN--GAIVNIASTRA--HQSEPDSEAYAASKGGLLALTHALAASLG-PDIRVNALSPG 187          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CBR4_DANRE (Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.072e-15
Identity = 70/216 (32.41%), Postives = 100/216 (46.30%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAF----GRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFG 640
            G S G+GR     LA+ G RIV  +R  +  +S       QS      + +  DVS      E  VQ A+E      G +  LVN AG++      L    E+   ++ TNL GS L  K     M   +  G+++NI S+         G   Y++SKAGL   T+ L+ E+    IRVN + PGL  +++T GL ++      A RT PL  FG
Sbjct:    9 GGSRGIGRAASKLLAQRGHRIVLLSRNKEAAQSTA-----QSLPGENHLGLSCDVSK-----EEEVQKAFETINKTCGTVGFLVNAAGINRDALL-LRSKSEDMLSVLHTNLLGSMLTCKAAVRNM--LSHGGAIVNIGSVVGVKGNA--GQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDMTAGLAEE-----AAVRTIPLGRFG 204          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHRS4_RAT (Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.624e-15
Identity = 65/236 (27.54%), Postives = 109/236 (46.19%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            T ++ G+G      LA+ G  +V ++R+   +      +  + G SV  +   +  + +    E  V MA +    ID LV+NA V+    + +D+TEE WN ++  N+T S ++ K V   M +    GSV+ +SS+A       P    Y  SK  L  +TK  + EL    IRVN + PGL K+  +  L K+     +   T  +R  G  +  +  +V +L  + +    G
Sbjct:   20 TASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGE-GLSVTGVVCHVGKAEDR---EKLVNMALKLHQGIDILVSNAAVNPFFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAM-EKRGGGSVVIVSSVAGFV--LFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHFSSVLWKEKAREEMIKETMQIRRLGKPEDCV-GIVSFLCSEDASYING 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BACC2_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.624e-15
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTE-EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNN 604
            TG +SG+G             +V A   +D  +    E   +  ++ R   V  D++ +  A +N+++ A + FG +D L+NNAG+   + +P+   E   WN ++  NLTG +L+SK+    M  + + G++IN  S+        P   AY +SK G+  +T+ ++++   H IRVN +CPG+  + + E    K +L N
Sbjct:   11 TGGASGIGYAAVQAFLNQQANVVVAD--IDEAQG---EAMIRKENNDRLHFVHTDIT-DEPACQNAIRSAVDKFGGLDVLINNAGIE--IVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGK-GNIINTCSVGGVVAW--PDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNE----KSFLEN 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y2146_BRAJA (Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium japonicum GN=blr2146 PE=3 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 8.651e-15
Identity = 69/239 (28.87%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAV---KSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA +G+G+   L +A+ G R+V A        +   +I  ++G    A+A+ +D+ A+  A+    + A   FG +D LVNNA         ++ L+L    W+  M TNL G+ L  +    RM  A   G+++N+SS    S        +YA+SKA +N ++  L+ + G  +IR N++ PGL  +E    L K D       R + L         + +LV +L+ D +    G
Sbjct:   12 TGAGAGIGKACALAIAREGGRVVVADIDGSAAIACTAQIAAEAG---HALALAIDI-ADAQAVAALFETAERHFGGVDLLVNNASAMHLTPRDRAILELELAVWDQTMATNLRGTLLCCRQAIPRMI-ARGGGAIVNMSSCQGLSGDTAL--TSYAASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTE--RLLAKLDACMQTHLRRHQLLPRVGRPEDVAALVAFLLSDDAAFITG 241          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
Y4LA_RHISN2.973e-1529.88Uncharacterized short-chain type dehydrogenase/red... [more]
KDUD_DICD32.973e-1527.842-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=D... [more]
DCXR_MOUSE2.973e-1534.97L-xylulose reductase OS=Mus musculus GN=Dcxr PE=2 ... [more]
STCU_EMENI3.883e-1529.69Versicolorin reductase OS=Emericella nidulans GN=s... [more]
FABG_VIBHA3.883e-1528.873-oxoacyl-[acyl-carrier-protein] reductase OS=Vibr... [more]
Y3106_PSEAE5.072e-1534.24Uncharacterized oxidoreductase PA3106 OS=Pseudomon... [more]
CBR4_DANRE5.072e-1532.41Carbonyl reductase family member 4 OS=Danio rerio ... [more]
DHRS4_RAT6.624e-1527.54Dehydrogenase/reductase SDR family member 4 OS=Rat... [more]
BACC2_BACSU6.624e-1528.71Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
Y2146_BRAJA8.651e-1528.87Probable short-chain type dehydrogenase/reductase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top